BLASTX nr result
ID: Phellodendron21_contig00046607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046607 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KXT10216.1 hypothetical protein AC579_3734 [Pseudocercospora musae] 64 1e-09 KXS95966.1 hypothetical protein AC578_8078 [Mycosphaerella eumusae] 62 5e-09 EME39531.1 hypothetical protein DOTSEDRAFT_91849 [Dothistroma se... 55 1e-06 XP_016758148.1 hypothetical protein SEPMUDRAFT_151090 [Sphaeruli... 54 2e-06 >KXT10216.1 hypothetical protein AC579_3734 [Pseudocercospora musae] Length = 402 Score = 63.5 bits (153), Expect = 1e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 172 FPDATTTGTSASPFHLTGLPTVAGAGIPTLVIPYTAAA 285 FPDATTT ++ S F LTGLPT+AGAGIPTLVIPYTA A Sbjct: 92 FPDATTTTSAGSVFQLTGLPTIAGAGIPTLVIPYTANA 129 >KXS95966.1 hypothetical protein AC578_8078 [Mycosphaerella eumusae] Length = 400 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 172 FPDATTTGTSASPFHLTGLPTVAGAGIPTLVIPYTAAA 285 FPDATTT ++ S F LTGLPT+AG G+PTLVIPYTA A Sbjct: 88 FPDATTTTSAGSVFQLTGLPTIAGVGVPTLVIPYTANA 125 >EME39531.1 hypothetical protein DOTSEDRAFT_91849 [Dothistroma septosporum NZE10] Length = 393 Score = 54.7 bits (130), Expect = 1e-06 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = +1 Query: 172 FPDATTT---GTSASPFHLTGLPTVAGAGIPTLVIPYTAAA 285 FP TT GT+ S F LTGLPT+AGAGIPT+++PYTA A Sbjct: 81 FPTGVTTNTAGTTGSVFSLTGLPTIAGAGIPTMIVPYTANA 121 >XP_016758148.1 hypothetical protein SEPMUDRAFT_151090 [Sphaerulina musiva SO2202] EMF10027.1 hypothetical protein SEPMUDRAFT_151090 [Sphaerulina musiva SO2202] Length = 402 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +1 Query: 172 FPDATTTGTSASPFHLTGLPTVAGAGIPTLVIPYTAAA 285 FPDAT+T +S + F LT LPT+AGAG+PT+V+PYTA A Sbjct: 86 FPDATST-SSGTTFRLTDLPTIAGAGVPTIVVPYTANA 122