BLASTX nr result
ID: Phellodendron21_contig00046545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046545 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO75222.1 hypothetical protein CISIN_1g0022182mg [Citrus sinensis] 67 4e-11 KDO75223.1 hypothetical protein CISIN_1g0022182mg [Citrus sinens... 67 4e-11 XP_006468329.1 PREDICTED: small RNA 2'-O-methyltransferase-like ... 67 4e-11 KDO75225.1 hypothetical protein CISIN_1g0022182mg [Citrus sinensis] 67 4e-11 XP_006468327.1 PREDICTED: small RNA 2'-O-methyltransferase-like ... 67 4e-11 XP_006448879.1 hypothetical protein CICLE_v10014179mg [Citrus cl... 65 3e-10 GAV65633.1 dsrm domain-containing protein/Methyltransf_23 domain... 57 3e-07 XP_007213676.1 hypothetical protein PRUPE_ppa000980mg [Prunus pe... 53 5e-06 >KDO75222.1 hypothetical protein CISIN_1g0022182mg [Citrus sinensis] Length = 933 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 F AL+RDG+LYGSV A I V +SKL +LC LIN KVESSHLL + YI RAATRLS Sbjct: 133 FIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLL--VLTYIMRAATRLS 189 >KDO75223.1 hypothetical protein CISIN_1g0022182mg [Citrus sinensis] KDO75224.1 hypothetical protein CISIN_1g0022182mg [Citrus sinensis] Length = 951 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 F AL+RDG+LYGSV A I V +SKL +LC LIN KVESSHLL + YI RAATRLS Sbjct: 133 FIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLL--VLTYIMRAATRLS 189 >XP_006468329.1 PREDICTED: small RNA 2'-O-methyltransferase-like isoform X2 [Citrus sinensis] Length = 951 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 F AL+RDG+LYGSV A I V +SKL +LC LIN KVESSHLL + YI RAATRLS Sbjct: 133 FIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLL--VLTYIMRAATRLS 189 >KDO75225.1 hypothetical protein CISIN_1g0022182mg [Citrus sinensis] Length = 952 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 F AL+RDG+LYGSV A I V +SKL +LC LIN KVESSHLL + YI RAATRLS Sbjct: 133 FIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLL--VLTYIMRAATRLS 189 >XP_006468327.1 PREDICTED: small RNA 2'-O-methyltransferase-like isoform X1 [Citrus sinensis] XP_006468328.1 PREDICTED: small RNA 2'-O-methyltransferase-like isoform X1 [Citrus sinensis] Length = 952 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 F AL+RDG+LYGSV A I V +SKL +LC LIN KVESSHLL + YI RAATRLS Sbjct: 133 FIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLL--VLTYIMRAATRLS 189 >XP_006448879.1 hypothetical protein CICLE_v10014179mg [Citrus clementina] ESR62119.1 hypothetical protein CICLE_v10014179mg [Citrus clementina] Length = 938 Score = 65.1 bits (157), Expect = 3e-10 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 F AL+RDG+LYGSV A I V +SKL +LC LIN KVESSHLL + Y RAATRLS Sbjct: 120 FIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLL--VLTYSMRAATRLS 176 >GAV65633.1 dsrm domain-containing protein/Methyltransf_23 domain-containing protein [Cephalotus follicularis] Length = 953 Score = 56.6 bits (135), Expect = 3e-07 Identities = 33/59 (55%), Positives = 41/59 (69%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLS 75 FR AL+RDG+LYGS+ A I V +SKL +LC +N KVES+ LL + YI AA RLS Sbjct: 133 FRAALKRDGDLYGSIPASVISVCDSKLCNLCKSLNPKVESNPLL--VISYIMGAAARLS 189 >XP_007213676.1 hypothetical protein PRUPE_ppa000980mg [Prunus persica] ONI11183.1 hypothetical protein PRUPE_4G091400 [Prunus persica] ONI11184.1 hypothetical protein PRUPE_4G091400 [Prunus persica] ONI11185.1 hypothetical protein PRUPE_4G091400 [Prunus persica] ONI11186.1 hypothetical protein PRUPE_4G091400 [Prunus persica] ONI11187.1 hypothetical protein PRUPE_4G091400 [Prunus persica] Length = 942 Score = 53.1 bits (126), Expect = 5e-06 Identities = 28/61 (45%), Positives = 41/61 (67%) Frame = -2 Query: 251 FRVALQRDGNLYGSVSAFTIDVFNSKLGSLC*LINHKVESSHLLLWIYIYITRAATRLSR 72 FR ALQRDG+L G + A I +F++ L ++C ++ KVES+ L + +Y+ RAA RLS Sbjct: 121 FRAALQRDGDLSGQIPASVIAIFDATLCNMCKSLDPKVESNPFL--VILYVVRAAARLSE 178 Query: 71 L 69 L Sbjct: 179 L 179