BLASTX nr result
ID: Phellodendron21_contig00046527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046527 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005647309.1 hypothetical protein COCSUDRAFT_63901 [Coccomyxa ... 61 7e-10 >XP_005647309.1 hypothetical protein COCSUDRAFT_63901 [Coccomyxa subellipsoidea C-169] EIE22765.1 hypothetical protein COCSUDRAFT_63901 [Coccomyxa subellipsoidea C-169] Length = 100 Score = 61.2 bits (147), Expect = 7e-10 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 6/61 (9%) Frame = -1 Query: 173 KGVIPGLAQWPPKAITEHGEPKPEDDPKNYDVISG-----ERTGGPSEAEL-EKIKEERN 12 +GV+PGL WPPK ITE G PKPEDDP N G +R GPS+ E+ EK K++R Sbjct: 17 EGVLPGLKNWPPKGITESGNPKPEDDPLNQAAEQGNVQGYKRVDGPSDEEVAEKKKKQRE 76 Query: 11 K 9 + Sbjct: 77 E 77