BLASTX nr result
ID: Phellodendron21_contig00046423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046423 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006425697.1 hypothetical protein CICLE_v10025093mg [Citrus cl... 62 1e-11 >XP_006425697.1 hypothetical protein CICLE_v10025093mg [Citrus clementina] XP_006467145.1 PREDICTED: proline-rich receptor-like protein kinase PERK4 [Citrus sinensis] ESR38937.1 hypothetical protein CICLE_v10025093mg [Citrus clementina] KDO79517.1 hypothetical protein CISIN_1g006083mg [Citrus sinensis] Length = 662 Score = 61.6 bits (148), Expect(2) = 1e-11 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 1 GVRPGQSFAFGALNTSTKYSAASYNNDMKEFRQLAFGQPRF 123 GVRPGQS AF A NTST+YSA SYN DMK+FRQLA G F Sbjct: 601 GVRPGQSSAFSASNTSTEYSATSYNADMKKFRQLALGSQDF 641 Score = 34.7 bits (78), Expect(2) = 1e-11 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +2 Query: 107 LASQDFTSSEL*WG-DSREIPTPKQRI 184 L SQDF SS+ DSREIPTPKQRI Sbjct: 636 LGSQDFASSDYGGSSDSREIPTPKQRI 662