BLASTX nr result
ID: Phellodendron21_contig00046405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046405 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003171118.1 glycosyl hydrolase [Nannizzia gypsea CBS 118893] ... 56 8e-07 CZR61927.1 related to putative alpha-1,2-mannosidase [Phialoceph... 55 2e-06 >XP_003171118.1 glycosyl hydrolase [Nannizzia gypsea CBS 118893] EFR04110.1 glycosyl hydrolase [Nannizzia gypsea CBS 118893] Length = 812 Score = 55.8 bits (133), Expect = 8e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -2 Query: 311 NGGGTIDFVLGTEQTSWDTGALPPSPGH 228 NGGGTI+FVLG E+TSWDTG LPPSPG+ Sbjct: 780 NGGGTIEFVLGPEKTSWDTGELPPSPGY 807 >CZR61927.1 related to putative alpha-1,2-mannosidase [Phialocephala subalpina] Length = 827 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -2 Query: 323 DLVGNGGGTIDFVLGTEQTSWDTGALPPSPGHYTV 219 DLVG GG I FVLG+EQT WD G +PPSPGH + Sbjct: 789 DLVGGDGGGIHFVLGSEQTEWDVGDVPPSPGHMDI 823