BLASTX nr result
ID: Phellodendron21_contig00046403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046403 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001941123.1 40S ribosomal protein S24 [Pyrenophora tritici-re... 52 6e-06 OAL48322.1 hypothetical protein IQ07DRAFT_613031 [Pyrenochaeta s... 52 6e-06 XP_003840854.1 hypothetical protein LEMA_P105060.1 [Leptosphaeri... 52 8e-06 >XP_001941123.1 40S ribosomal protein S24 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003298926.1 40S ribosomal protein S24 [Pyrenophora teres f. teres 0-1] EDU43842.1 40S ribosomal protein S24 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ92978.1 hypothetical protein PTT_09788 [Pyrenophora teres f. teres 0-1] Length = 134 Score = 52.0 bits (123), Expect = 6e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -2 Query: 366 DSNEAMKQFEPRYRLVRYGLATKVEXXXXXXXXXXXXXXKEFR 238 DSNEAMK+FEPRYRLVRYG+ATKVE KEFR Sbjct: 78 DSNEAMKKFEPRYRLVRYGMATKVEKASRQQRKQRKNRMKEFR 120 >OAL48322.1 hypothetical protein IQ07DRAFT_613031 [Pyrenochaeta sp. DS3sAY3a] Length = 134 Score = 52.0 bits (123), Expect = 6e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -2 Query: 366 DSNEAMKQFEPRYRLVRYGLATKVEXXXXXXXXXXXXXXKEFR 238 DSNEAMK+FEPRYRLVRYG+ATKVE KEFR Sbjct: 78 DSNEAMKKFEPRYRLVRYGMATKVEKASRQQRKQRKNRMKEFR 120 >XP_003840854.1 hypothetical protein LEMA_P105060.1 [Leptosphaeria maculans JN3] CBX97375.1 hypothetical protein LEMA_P105060.1 [Leptosphaeria maculans JN3] Length = 158 Score = 52.0 bits (123), Expect = 8e-06 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -2 Query: 366 DSNEAMKQFEPRYRLVRYGLATKVEXXXXXXXXXXXXXXKEFR 238 DSNEAMK+FEPRYRLVRYG+ATKVE KEFR Sbjct: 102 DSNEAMKKFEPRYRLVRYGMATKVEKASRQQRKQRKNRMKEFR 144