BLASTX nr result
ID: Phellodendron21_contig00046320
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046320 (441 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001591651.1 predicted protein [Sclerotinia sclerotiorum 1980]... 59 9e-08 ESZ98067.1 hypothetical protein SBOR_1598 [Sclerotinia borealis ... 59 1e-07 APA10416.1 hypothetical protein sscle_06g051860 [Sclerotinia scl... 59 2e-07 >XP_001591651.1 predicted protein [Sclerotinia sclerotiorum 1980] EDO04614.1 predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 212 Score = 58.9 bits (141), Expect = 9e-08 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -1 Query: 438 HLMASVELIQSLDKPPGKAADWWRAYESAAEEVHHGADMRMDMVSIVGQKP 286 HLMASVE+ +++ G A +WW + A E++HGA +RM MVS+ G+KP Sbjct: 160 HLMASVEMGSIIERERGNAEEWWNMHRRAIAEMYHGASLRMSMVSVAGRKP 210 >ESZ98067.1 hypothetical protein SBOR_1598 [Sclerotinia borealis F-4128] Length = 295 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -1 Query: 438 HLMASVELIQSLDKPPGKAADWWRAYESAAEEVHHGADMRMDMVSIVGQKP 286 HLMASVE+ + +++ G A +WW + A E++HGA +RM MVS+ G+KP Sbjct: 243 HLMASVEMGRIIERERGNAEEWWNMHHRAIAEMYHGASLRMSMVSVAGRKP 293 >APA10416.1 hypothetical protein sscle_06g051860 [Sclerotinia sclerotiorum 1980 UF-70] Length = 295 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -1 Query: 438 HLMASVELIQSLDKPPGKAADWWRAYESAAEEVHHGADMRMDMVSIVGQKP 286 HLMASVE+ +++ G A +WW + A E++HGA +RM MVS+ G+KP Sbjct: 243 HLMASVEMGSIIERERGNAEEWWNMHRRAIAEMYHGASLRMSMVSVAGRKP 293