BLASTX nr result
ID: Phellodendron21_contig00046306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046306 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005647213.1 hypothetical protein COCSUDRAFT_33358 [Coccomyxa ... 68 6e-13 XP_007005220.1 hypothetical protein TREMEDRAFT_73991 [Tremella m... 51 5e-06 >XP_005647213.1 hypothetical protein COCSUDRAFT_33358 [Coccomyxa subellipsoidea C-169] EIE22669.1 hypothetical protein COCSUDRAFT_33358 [Coccomyxa subellipsoidea C-169] Length = 67 Score = 68.2 bits (165), Expect = 6e-13 Identities = 30/62 (48%), Positives = 43/62 (69%) Frame = -1 Query: 261 DDTLKWVLIAGAVIAGGFILYNIIQNDDEAKRALKDAKGQAKGAWSEAKGQAKGAYNEAK 82 D T+K ++I A + GG +L+ II+NDD + A KD KG KG + +AKG+AKGAY +AK Sbjct: 5 DQTIKQIVIGVAAVLGGLVLWKIIKNDDSIEGAAKDVKGDLKGRFKDAKGEAKGAYKDAK 64 Query: 81 GD 76 + Sbjct: 65 SN 66 >XP_007005220.1 hypothetical protein TREMEDRAFT_73991 [Tremella mesenterica DSM 1558] EIW68996.1 hypothetical protein TREMEDRAFT_73991 [Tremella mesenterica DSM 1558] Length = 100 Score = 51.2 bits (121), Expect = 5e-06 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = -1 Query: 261 DDTLKWVLIAGAVIAGGFILYNIIQNDDEAKRALKDAKGQAKGAWSEAKGQAKGAYNEAK 82 D+TL + A + G+ + D+ AK + A+G AKGA SE G+AKGAYNEAK Sbjct: 34 DNTLLYAAAAVGLAGVGYYFF-AAGGDNVAKGRVAQAEGHAKGAASELSGEAKGAYNEAK 92 Query: 81 GDVQR 67 G+V + Sbjct: 93 GEVNK 97