BLASTX nr result
ID: Phellodendron21_contig00046303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046303 (420 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAM85322.1 hypothetical protein ANO11243_033270 [fungal sp. No.1... 54 4e-06 >GAM85322.1 hypothetical protein ANO11243_033270 [fungal sp. No.11243] Length = 163 Score = 53.5 bits (127), Expect = 4e-06 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = -1 Query: 186 PALSKITTNTQHTWKTDXXXXXXXSACRYHLDERDHSRIVVFDWHGAIEFMSGEQELANK 7 P +SK++TNTQ TW+T SA RY LD D + I+VFDW G+IE + ++ L + Sbjct: 8 PPISKVSTNTQTTWQTTTSGSSSTSASRYGLDVDDPASILVFDWDGSIE-KTSQRRLCAE 66 Query: 6 LD 1 LD Sbjct: 67 LD 68