BLASTX nr result
ID: Phellodendron21_contig00046189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046189 (525 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010095490.1 hypothetical protein L484_014917 [Morus notabilis... 56 5e-06 >XP_010095490.1 hypothetical protein L484_014917 [Morus notabilis] EXB60464.1 hypothetical protein L484_014917 [Morus notabilis] Length = 2687 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 521 WGIWLERNSRIFNGIEADPAFVWNKIKFWVALWV 420 W +WLERN+ IF IE D VW++IKFWVALWV Sbjct: 914 WALWLERNNHIFEDIEGDVIDVWDRIKFWVALWV 947