BLASTX nr result
ID: Phellodendron21_contig00046176
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046176 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KXL42721.1 hypothetical protein FE78DRAFT_93418 [Acidomyces rich... 74 5e-13 KZM24571.1 damaged DNA binding [Ascochyta rabiei] 72 2e-12 XP_001791979.1 hypothetical protein SNOG_01337 [Parastagonospora... 72 4e-12 OAL55535.1 UV excision repair protein Rad23 [Pyrenochaeta sp. DS... 71 5e-12 KXT05883.1 hypothetical protein AC578_348 [Mycosphaerella eumusae] 69 4e-11 OGE49157.1 hypothetical protein PENARI_c023G03636 [Penicillium a... 69 4e-11 XP_002148019.1 UV excision repair protein (RadW), putative [Tala... 68 8e-11 XP_002482264.1 UV excision repair protein (RadW), putative [Tala... 68 8e-11 KEQ65140.1 UV excision repair protein Rad23 [Aureobasidium melan... 68 8e-11 XP_013431255.1 UV excision repair protein Rad23 [Aureobasidium n... 68 8e-11 OJD18191.1 UV excision repair protein Rad23 [Emmonsia pasteurian... 68 8e-11 OJD13441.1 UV excision repair protein Rad23, partial [Blastomyce... 67 1e-10 EEH17710.2 UV excision repair protein Rad23 [Paracoccidioides br... 67 1e-10 XP_002793420.1 hypothetical protein PAAG_04949 [Paracoccidioides... 67 1e-10 OAL01881.1 UV excision repair protein Rad23 [Stagonospora sp. SR... 67 1e-10 ODH19778.1 UV excision repair protein Rad23 [Paracoccidioides br... 67 1e-10 XP_010758565.1 UV excision repair protein Rad23 [Paracoccidioide... 67 1e-10 ODH51091.1 UV excision repair protein Rad23 [Paracoccidioides br... 67 1e-10 OAX81597.1 UV excision repair protein Rad23 [Emmonsia sp. CAC-20... 67 1e-10 XP_002625197.1 UV excision repair protein Rad23 [Blastomyces gil... 67 1e-10 >KXL42721.1 hypothetical protein FE78DRAFT_93418 [Acidomyces richmondensis] KYG49472.1 hypothetical protein M433DRAFT_149977 [Acidomyces richmondensis BFW] Length = 390 Score = 73.9 bits (180), Expect = 5e-13 Identities = 43/90 (47%), Positives = 46/90 (51%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 +MGFPR IDRAMRAAFFNPDRAVEYLLNGIP SP Sbjct: 152 SMGFPREQIDRAMRAAFFNPDRAVEYLLNGIPASAEQEQRPAVASP------------RV 199 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 G TG ASGEEP+NLF+ Sbjct: 200 QSSQTQQAQTGTTGTEGAAASGEEPVNLFE 229 >KZM24571.1 damaged DNA binding [Ascochyta rabiei] Length = 388 Score = 72.4 bits (176), Expect = 2e-12 Identities = 41/90 (45%), Positives = 48/90 (53%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 +MGF R+DIDRAMRAAFFNPDRAVEYLL GIP S + Sbjct: 153 SMGFARADIDRAMRAAFFNPDRAVEYLLTGIP-------------ESALQEQAQQQAQAR 199 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 GNT ATP + G+EP+NLF+ Sbjct: 200 APTSPPPAAGGNTSATPAASGGDEPINLFE 229 >XP_001791979.1 hypothetical protein SNOG_01337 [Parastagonospora nodorum SN15] EAT90986.2 hypothetical protein SNOG_01337 [Parastagonospora nodorum SN15] Length = 386 Score = 71.6 bits (174), Expect = 4e-12 Identities = 42/92 (45%), Positives = 51/92 (55%), Gaps = 2/92 (2%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRS--PSNVXXXXXXXXX 148 +MGF R+DID AMRAAFFNPDRAVEYLL GIP ++ PS+ Sbjct: 129 SMGFARADIDAAMRAAFFNPDRAVEYLLTGIPDSARQEQAQAAQANAPSS---------- 178 Query: 147 XXXXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 GNTGAT P+ G+EP+NLF+ Sbjct: 179 ------PTPAAGGNTGATAAPSGGDEPINLFE 204 >OAL55535.1 UV excision repair protein Rad23 [Pyrenochaeta sp. DS3sAY3a] Length = 380 Score = 71.2 bits (173), Expect = 5e-12 Identities = 42/90 (46%), Positives = 51/90 (56%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 AMGF R+DIDRAMRAAFFNPDRAVEYLLNGIP S +N Sbjct: 154 AMGFARADIDRAMRAAFFNPDRAVEYLLNGIP--ESARQEQPQASQANA----------- 200 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 +G+TGA+ P+ +EP+NLF+ Sbjct: 201 --PTSPPPAEGSTGASVAPSGADEPINLFE 228 >KXT05883.1 hypothetical protein AC578_348 [Mycosphaerella eumusae] Length = 1562 Score = 68.9 bits (167), Expect = 4e-11 Identities = 43/91 (47%), Positives = 46/91 (50%), Gaps = 1/91 (1%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 AMGFPR ID AMRAAFFNPDRAVEYLLNGIP SP Sbjct: 152 AMGFPRDQIDAAMRAAFFNPDRAVEYLLNGIPESARQEQRPAAASP-------------- 197 Query: 141 XXXXXXXXXQGNTGATPQP-ASGEEPLNLFD 52 G T AT P A G+EP+NLF+ Sbjct: 198 RPASQQAQQPGATTATETPQAGGDEPVNLFE 228 >OGE49157.1 hypothetical protein PENARI_c023G03636 [Penicillium arizonense] Length = 372 Score = 68.6 bits (166), Expect = 4e-11 Identities = 40/90 (44%), Positives = 45/90 (50%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 AMGF RSDIDRAMRAAFFNPDRA+EYLL GIP + + Sbjct: 153 AMGFARSDIDRAMRAAFFNPDRAIEYLLTGIPDNIQEQQQQQQQEAA------------- 199 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 T P P+ GEEPLNLF+ Sbjct: 200 --------APAPTADAPAPSGGEEPLNLFE 221 >XP_002148019.1 UV excision repair protein (RadW), putative [Talaromyces marneffei ATCC 18224] EEA24508.1 UV excision repair protein (RadW), putative [Talaromyces marneffei ATCC 18224] KFX44410.1 UV excision repair protein rhp23 [Talaromyces marneffei PM1] Length = 372 Score = 67.8 bits (164), Expect = 8e-11 Identities = 38/90 (42%), Positives = 46/90 (51%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 AMGFPR+DIDRAMRAAFFNPDRAV+YLLNGIP N+ Sbjct: 152 AMGFPRADIDRAMRAAFFNPDRAVDYLLNGIP--------------ENIEQEHAQARAAA 197 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 A A+G++P+NLF+ Sbjct: 198 ASPSAATTPAAAVAAVAPEATGDDPVNLFE 227 >XP_002482264.1 UV excision repair protein (RadW), putative [Talaromyces stipitatus ATCC 10500] EED18272.1 UV excision repair protein (RadW), putative [Talaromyces stipitatus ATCC 10500] Length = 375 Score = 67.8 bits (164), Expect = 8e-11 Identities = 40/90 (44%), Positives = 49/90 (54%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 AMGFPR+DIDRAMRAAFFNPDRAV+YLLNGIP + ++ Sbjct: 153 AMGFPRADIDRAMRAAFFNPDRAVDYLLNGIPENIQQEQTQARAAATS------------ 200 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 T A P+ A+G EP+NLF+ Sbjct: 201 -PAPAPAPAPATTPAAPE-ATGNEPVNLFE 228 >KEQ65140.1 UV excision repair protein Rad23 [Aureobasidium melanogenum CBS 110374] Length = 376 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 AMGFPR+DIDRAMRAAFFNPDRAVEYLLNGIP Sbjct: 148 AMGFPRADIDRAMRAAFFNPDRAVEYLLNGIP 179 >XP_013431255.1 UV excision repair protein Rad23 [Aureobasidium namibiae CBS 147.97] KEQ77220.1 UV excision repair protein Rad23 [Aureobasidium namibiae CBS 147.97] Length = 380 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 AMGFPR+DIDRAMRAAFFNPDRAVEYLLNGIP Sbjct: 151 AMGFPRTDIDRAMRAAFFNPDRAVEYLLNGIP 182 >OJD18191.1 UV excision repair protein Rad23 [Emmonsia pasteuriana UAMH 9510] Length = 381 Score = 67.8 bits (164), Expect = 8e-11 Identities = 39/90 (43%), Positives = 46/90 (51%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP +P + Sbjct: 151 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIPETTQAEQREEPPAPPST----------- 199 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 G A PA +E +NLF+ Sbjct: 200 -----TAASGGAQPAAAAPAGDDEHVNLFE 224 >OJD13441.1 UV excision repair protein Rad23, partial [Blastomyces sp. CAC-2015b] Length = 348 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 118 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 149 >EEH17710.2 UV excision repair protein Rad23 [Paracoccidioides brasiliensis Pb03] Length = 363 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 138 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 169 >XP_002793420.1 hypothetical protein PAAG_04949 [Paracoccidioides lutzii Pb01] EEH33900.1 hypothetical protein PAAG_04949 [Paracoccidioides lutzii Pb01] Length = 375 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 150 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 181 >OAL01881.1 UV excision repair protein Rad23 [Stagonospora sp. SRC1lsM3a] Length = 378 Score = 67.4 bits (163), Expect = 1e-10 Identities = 39/90 (43%), Positives = 46/90 (51%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIPXXXXXXXXXXXRSPSNVXXXXXXXXXXX 142 +MGF R+DID AMRAAFFNPDRAVEYLLNGIP + Sbjct: 150 SMGFARADIDAAMRAAFFNPDRAVEYLLNGIP--------------DSARQEQAQAAQAN 195 Query: 141 XXXXXXXXXQGNTGATPQPASGEEPLNLFD 52 GNTGAT + G+E +NLF+ Sbjct: 196 APTSPTPAAAGNTGATAPSSGGDEHINLFE 225 >ODH19778.1 UV excision repair protein Rad23 [Paracoccidioides brasiliensis] Length = 379 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 154 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 185 >XP_010758565.1 UV excision repair protein Rad23 [Paracoccidioides brasiliensis Pb18] EEH46585.1 UV excision repair protein Rad23 [Paracoccidioides brasiliensis Pb18] Length = 379 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 154 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 185 >ODH51091.1 UV excision repair protein Rad23 [Paracoccidioides brasiliensis] Length = 383 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 158 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 189 >OAX81597.1 UV excision repair protein Rad23 [Emmonsia sp. CAC-2015a] Length = 386 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 156 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 187 >XP_002625197.1 UV excision repair protein Rad23 [Blastomyces gilchristii SLH14081] EGE83157.1 UV excision repair protein Rad23 [Blastomyces dermatitidis ATCC 18188] EQL28713.1 UV excision repair protein RAD23 [Blastomyces dermatitidis ATCC 26199] OAT08073.1 UV excision repair protein Rad23 [Blastomyces gilchristii SLH14081] Length = 386 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 321 AMGFPRSDIDRAMRAAFFNPDRAVEYLLNGIP 226 +MGFPRSDIDRAMRAAFFNPDRA+EYLLNGIP Sbjct: 156 SMGFPRSDIDRAMRAAFFNPDRAIEYLLNGIP 187