BLASTX nr result
ID: Phellodendron21_contig00046102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046102 (457 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002627788.1 antigenic thaumatin domain-containing protein [Bl... 53 8e-06 >XP_002627788.1 antigenic thaumatin domain-containing protein [Blastomyces gilchristii SLH14081] OAT06199.1 antigenic thaumatin domain-containing protein [Blastomyces gilchristii SLH14081] Length = 174 Score = 53.1 bits (126), Expect = 8e-06 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 1/89 (1%) Frame = +2 Query: 158 GQSVVHNSCQQDVYYMVSGAEGVAPTTEKLSPGGRFAMDYH-NLNGAGVAIFLSTVEKDI 334 G ++V N+C VY G P+ K+ PG F Y +G G ++ I Sbjct: 23 GNAIVKNNCPFPVYLQSVCENGNVPS-HKIEPGATFTEQYRAKPDGGGCSL-------KI 74 Query: 335 TDYTASNSLTRLEYTYNAEKLWYDVSNID 421 +D T+ + +T+ EYT + EK++YDVSNID Sbjct: 75 SDETSGSEITQFEYTLSGEKVFYDVSNID 103