BLASTX nr result
ID: Phellodendron21_contig00046090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046090 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAM87232.1 hypothetical protein ANO11243_052540 [fungal sp. No.1... 54 5e-06 >GAM87232.1 hypothetical protein ANO11243_052540 [fungal sp. No.11243] Length = 473 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/41 (60%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -3 Query: 388 GRYQDVERVAPGGGYCGGRKLLILPEE-DGGKWWNYHGPED 269 G YQDV+RVA GG+CGGRKLL LPE+ GG W++ P D Sbjct: 431 GGYQDVQRVAKPGGFCGGRKLLALPEDGHGGHWYSQSPPPD 471