BLASTX nr result
ID: Phellodendron21_contig00045966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045966 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL53364.1 ribosomal protein L36e [Pyrenochaeta sp. DS3sAY3a] 57 2e-08 KZM21599.1 structural constituent of ribosome [Ascochyta rabiei] 57 2e-08 KXS94484.1 hypothetical protein AC578_1714 [Mycosphaerella eumus... 57 2e-08 KXL51381.1 hypothetical protein FE78DRAFT_84003 [Acidomyces rich... 57 2e-08 XP_007928885.1 hypothetical protein MYCFIDRAFT_70836 [Pseudocerc... 57 2e-08 EME39696.1 hypothetical protein DOTSEDRAFT_75371 [Dothistroma se... 57 2e-08 XP_007681341.1 hypothetical protein BAUCODRAFT_28424 [Baudoinia ... 57 2e-08 OCL05908.1 ribosomal protein L36e [Glonium stellatum] 57 3e-08 OCK96740.1 ribosomal protein L36e [Cenococcum geophilum 1.58] 57 3e-08 XP_020131293.1 60s ribosomal protein l36 [Diplodia corticola] KK... 56 5e-08 XP_001939089.1 60S ribosomal protein L36 [Pyrenophora tritici-re... 56 5e-08 XP_007587300.1 putative 60s ribosomal protein l36 protein [Neofu... 56 5e-08 XP_008031535.1 hypothetical protein SETTUDRAFT_166386 [Setosphae... 56 5e-08 XP_007692313.1 hypothetical protein COCMIDRAFT_106853 [Bipolaris... 56 5e-08 XP_016758251.1 60S ribosomal protein L36 [Sphaerulina musiva SO2... 55 7e-08 XP_016213166.1 60S ribosomal protein L36 [Verruconis gallopava] ... 55 1e-07 EWC46294.1 60S ribosomal protein L36 [Drechslerella stenobrocha ... 55 1e-07 KOM23366.1 hypothetical protein XA68_4442 [Ophiocordyceps unilat... 54 4e-07 XP_001794331.1 hypothetical protein SNOG_03785 [Parastagonospora... 54 4e-07 XP_013341821.1 hypothetical protein AUEXF2481DRAFT_42094 [Aureob... 53 6e-07 >OAL53364.1 ribosomal protein L36e [Pyrenochaeta sp. DS3sAY3a] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARRLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >KZM21599.1 structural constituent of ribosome [Ascochyta rabiei] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARRLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >KXS94484.1 hypothetical protein AC578_1714 [Mycosphaerella eumusae] KXT07979.1 hypothetical protein AC579_6914 [Pseudocercospora musae] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >KXL51381.1 hypothetical protein FE78DRAFT_84003 [Acidomyces richmondensis] KYG50416.1 hypothetical protein M433DRAFT_148850 [Acidomyces richmondensis BFW] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >XP_007928885.1 hypothetical protein MYCFIDRAFT_70836 [Pseudocercospora fijiensis CIRAD86] EME79921.1 hypothetical protein MYCFIDRAFT_70836 [Pseudocercospora fijiensis CIRAD86] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >EME39696.1 hypothetical protein DOTSEDRAFT_75371 [Dothistroma septosporum NZE10] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >XP_007681341.1 hypothetical protein BAUCODRAFT_28424 [Baudoinia panamericana UAMH 10762] EMC91299.1 hypothetical protein BAUCODRAFT_28424 [Baudoinia panamericana UAMH 10762] Length = 106 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >OCL05908.1 ribosomal protein L36e [Glonium stellatum] Length = 106 Score = 56.6 bits (135), Expect = 3e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTK+IAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKIIAESRRAGH 106 >OCK96740.1 ribosomal protein L36e [Cenococcum geophilum 1.58] Length = 106 Score = 56.6 bits (135), Expect = 3e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTK+IAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKIIAESRRAGH 106 >XP_020131293.1 60s ribosomal protein l36 [Diplodia corticola] KKY16702.1 putative 60s ribosomal protein l36 [Diplodia seriata] OJD35033.1 60s ribosomal protein l36 [Diplodia corticola] OMP84111.1 60S ribosomal protein L36 [Diplodia seriata] Length = 105 Score = 55.8 bits (133), Expect = 5e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAE+RRAGH Sbjct: 66 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAEARRAGH 105 >XP_001939089.1 60S ribosomal protein L36 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003302655.1 60S ribosomal protein L36 [Pyrenophora teres f. teres 0-1] EDU41808.1 60S ribosomal protein L36 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ89255.1 hypothetical protein PTT_14563 [Pyrenophora teres f. teres 0-1] Length = 106 Score = 55.8 bits (133), Expect = 5e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGR+KRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARRLAKKRLGTFGRSKRKVDEMTKVIAESRRAGH 106 >XP_007587300.1 putative 60s ribosomal protein l36 protein [Neofusicoccum parvum UCRNP2] EOD45224.1 putative 60s ribosomal protein l36 protein [Neofusicoccum parvum UCRNP2] Length = 106 Score = 55.8 bits (133), Expect = 5e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAE+RRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAEARRAGH 106 >XP_008031535.1 hypothetical protein SETTUDRAFT_166386 [Setosphaeria turcica Et28A] XP_018386421.1 ribosomal protein L36e [Alternaria alternata] EOA80963.1 hypothetical protein SETTUDRAFT_166386 [Setosphaeria turcica Et28A] OAG21000.1 ribosomal protein L36e [Alternaria alternata] Length = 106 Score = 55.8 bits (133), Expect = 5e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGR+KRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARRLAKKRLGTFGRSKRKVDEMTKVIAESRRAGH 106 >XP_007692313.1 hypothetical protein COCMIDRAFT_106853 [Bipolaris oryzae ATCC 44560] XP_007702410.1 hypothetical protein COCSADRAFT_227912 [Bipolaris sorokiniana ND90Pr] XP_007707117.1 hypothetical protein COCCADRAFT_82570 [Bipolaris zeicola 26-R-13] XP_014079758.1 hypothetical protein COCC4DRAFT_71532 [Bipolaris maydis ATCC 48331] XP_014561530.1 hypothetical protein COCVIDRAFT_86382 [Bipolaris victoriae FI3] EMD62087.1 hypothetical protein COCSADRAFT_227912 [Bipolaris sorokiniana ND90Pr] EMD91068.1 hypothetical protein COCHEDRAFT_1176853 [Bipolaris maydis C5] ENI05849.1 hypothetical protein COCC4DRAFT_71532 [Bipolaris maydis ATCC 48331] EUC38705.1 hypothetical protein COCCADRAFT_82570 [Bipolaris zeicola 26-R-13] EUC41173.1 hypothetical protein COCMIDRAFT_106853 [Bipolaris oryzae ATCC 44560] EUN31916.1 hypothetical protein COCVIDRAFT_86382 [Bipolaris victoriae FI3] Length = 106 Score = 55.8 bits (133), Expect = 5e-08 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGR+KRKVDEMTKVIAESRRAGH Sbjct: 67 NSKDKRARRLAKKRLGTFGRSKRKVDEMTKVIAESRRAGH 106 >XP_016758251.1 60S ribosomal protein L36 [Sphaerulina musiva SO2202] EMF10130.1 60S ribosomal protein L36 [Sphaerulina musiva SO2202] Length = 106 Score = 55.5 bits (132), Expect = 7e-08 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMTKVIAESRR GH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKRKVDEMTKVIAESRRVGH 106 >XP_016213166.1 60S ribosomal protein L36 [Verruconis gallopava] KIW03297.1 60S ribosomal protein L36 [Verruconis gallopava] Length = 106 Score = 55.1 bits (131), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD G+FGRAKRKVDEMTK+IAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGSFGRAKRKVDEMTKIIAESRRAGH 106 >EWC46294.1 60S ribosomal protein L36 [Drechslerella stenobrocha 248] Length = 103 Score = 54.7 bits (130), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDE+T+VIAESRRAGH Sbjct: 64 NSKDKRARKLAKKRLGTFGRAKRKVDELTRVIAESRRAGH 103 >KOM23366.1 hypothetical protein XA68_4442 [Ophiocordyceps unilateralis] Length = 106 Score = 53.5 bits (127), Expect = 4e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAK+KVDE+T+VIAESRRAGH Sbjct: 67 NSKDKRARKLAKKRLGTFGRAKKKVDELTRVIAESRRAGH 106 >XP_001794331.1 hypothetical protein SNOG_03785 [Parastagonospora nodorum SN15] EAT88990.1 hypothetical protein SNOG_03785 [Parastagonospora nodorum SN15] OAL06685.1 ribosomal protein L36e [Stagonospora sp. SRC1lsM3a] Length = 106 Score = 53.5 bits (127), Expect = 4e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKV+EMT VIAESRRAGH Sbjct: 67 NSKDKRARRLAKKRLGTFGRAKRKVEEMTNVIAESRRAGH 106 >XP_013341821.1 hypothetical protein AUEXF2481DRAFT_42094 [Aureobasidium subglaciale EXF-2481] KEQ93366.1 hypothetical protein AUEXF2481DRAFT_42094 [Aureobasidium subglaciale EXF-2481] Length = 106 Score = 53.1 bits (126), Expect = 6e-07 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = +2 Query: 2 NSKDXXXXXXXXXXXGTFGRAKRKVDEMTKVIAESRRAGH 121 NSKD GTFGRAKRKVDEMT IAESRRAGH Sbjct: 67 NSKDKRARKLAKRRLGTFGRAKRKVDEMTNYIAESRRAGH 106