BLASTX nr result
ID: Phellodendron21_contig00045887
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045887 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OCL08590.1 hypothetical protein AOQ84DRAFT_221733 [Glonium stell... 60 2e-08 OMP86383.1 hypothetical protein BK809_0003553 [Diplodia seriata] 55 6e-08 XP_007681044.1 hypothetical protein BAUCODRAFT_79361 [Baudoinia ... 57 2e-07 XP_020135405.1 sugar transporter [Diplodia corticola] OJD40562.1... 55 6e-07 KIN05737.1 hypothetical protein OIDMADRAFT_189244 [Oidiodendron ... 55 6e-07 XP_007589428.1 putative sugar transporter protein [Neofusicoccum... 55 9e-07 XP_018061186.1 hypothetical protein LY89DRAFT_398766 [Phialoceph... 54 2e-06 XP_011107171.1 hypothetical protein H072_1179 [Dactylellina hapt... 53 4e-06 KKY26837.1 putative sugar transporter [Diplodia seriata] 52 8e-06 >OCL08590.1 hypothetical protein AOQ84DRAFT_221733 [Glonium stellatum] Length = 645 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQDGQRRKS 118 MKYQ +A P+FI+RYI R K+ L+PLY FD LASEQ R+ + +G R +S Sbjct: 585 MKYQATKAFPWFIQRYIFRNKSAQLEPLYKFDSHLASEQARAVSISEGVRNRS 637 >OMP86383.1 hypothetical protein BK809_0003553 [Diplodia seriata] Length = 94 Score = 55.1 bits (131), Expect = 6e-08 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQD 136 M YQV +A PYFI R++ KN L+PLY FD+ LAS+Q RS V + Sbjct: 48 MSYQVTKALPYFINRWVFLNKNATLEPLYKFDEHLASDQARSKSVSN 94 >XP_007681044.1 hypothetical protein BAUCODRAFT_79361 [Baudoinia panamericana UAMH 10762] EMC91624.1 hypothetical protein BAUCODRAFT_79361 [Baudoinia panamericana UAMH 10762] Length = 632 Score = 57.0 bits (136), Expect = 2e-07 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQDGQ-RRKSSIVQKL 100 M YQV E+ PYF KR++ K+ LKPLYNFD + QR +S+ Q K + QK+ Sbjct: 571 MSYQVTESLPYFFKRWVAMNKSATLKPLYNFDHVASDAQRSASVTAYNQEHHKPAAQQKV 630 Query: 99 NL 94 NL Sbjct: 631 NL 632 >XP_020135405.1 sugar transporter [Diplodia corticola] OJD40562.1 sugar transporter [Diplodia corticola] Length = 631 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQD 136 M YQ+ + PYFIKR++L KN L+PLY FD LAS+Q RS V + Sbjct: 585 MSYQITKTLPYFIKRWVLLNKNATLEPLYQFDAHLASDQARSKSVSN 631 >KIN05737.1 hypothetical protein OIDMADRAFT_189244 [Oidiodendron maius Zn] Length = 665 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/55 (43%), Positives = 38/55 (69%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQDGQRRKSSI 112 M+YQ +A PYFI R+ILR+K+ VL+PLY FD A +++ R + + RR++ + Sbjct: 578 MRYQFSKALPYFINRWILRRKDAVLEPLYQFDSAGDTDESRIQALYENDRRRAEL 632 >XP_007589428.1 putative sugar transporter protein [Neofusicoccum parvum UCRNP2] EOD43104.1 putative sugar transporter protein [Neofusicoccum parvum UCRNP2] Length = 627 Score = 55.1 bits (131), Expect = 9e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQD 136 M YQ+ +A PYFIKR++ KN L+PLY FD+ LASEQ RS + + Sbjct: 581 MSYQMTKALPYFIKRWVFFNKNARLEPLYQFDEHLASEQARSKSISN 627 >XP_018061186.1 hypothetical protein LY89DRAFT_398766 [Phialocephala scopiformis] KUJ06831.1 hypothetical protein LY89DRAFT_398766 [Phialocephala scopiformis] Length = 659 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/62 (41%), Positives = 41/62 (66%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRRSSIVQDGQRRKSSIVQKLN 97 M+YQ+ +A PYFI RYILR+ N VL+PLY+FD + +++Q R + + R ++ +N Sbjct: 575 MRYQITQALPYFINRYILRRPNTVLEPLYHFDTS-SNDQDRIEAMYEADRVRAEKKNGIN 633 Query: 96 LN 91 N Sbjct: 634 GN 635 >XP_011107171.1 hypothetical protein H072_1179 [Dactylellina haptotyla CBS 200.50] EPS44823.1 hypothetical protein H072_1179 [Dactylellina haptotyla CBS 200.50] Length = 659 Score = 53.1 bits (126), Expect = 4e-06 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 9/61 (14%) Frame = -1 Query: 273 KYQVFEATPYFIKRYILRKKNVVLKPLYNFDQAL---------ASEQRRSSIVQDGQRRK 121 KYQ +A P+++KR ILRKKNV LKPLY+FD ++ S+ RR S V G RR Sbjct: 578 KYQWTQALPWWVKRNILRKKNVELKPLYHFDDSVFSSVEQKRRESQGRRKSSVASGIRRS 637 Query: 120 S 118 S Sbjct: 638 S 638 >KKY26837.1 putative sugar transporter [Diplodia seriata] Length = 480 Score = 52.4 bits (124), Expect = 8e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = -1 Query: 276 MKYQVFEATPYFIKRYILRKKNVVLKPLYNFDQALASEQRR 154 M YQV +A PYFI R++ KN L+PLY FD+ LAS+Q R Sbjct: 424 MSYQVTKALPYFINRWVFLNKNATLEPLYKFDEHLASDQAR 464