BLASTX nr result
ID: Phellodendron21_contig00045843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045843 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO59058.1 hypothetical protein CISIN_1g0091082mg [Citrus sinensis] 55 2e-06 KDO59057.1 hypothetical protein CISIN_1g0091082mg [Citrus sinensis] 55 2e-06 KDO59056.1 hypothetical protein CISIN_1g0091082mg, partial [Citr... 55 2e-06 KDO59052.1 hypothetical protein CISIN_1g0091082mg, partial [Citr... 55 2e-06 XP_006430747.1 hypothetical protein CICLE_v10011430mg [Citrus cl... 55 2e-06 XP_006482229.1 PREDICTED: plastidic glucose transporter 4 [Citru... 55 2e-06 XP_006430744.1 hypothetical protein CICLE_v10011430mg [Citrus cl... 55 2e-06 >KDO59058.1 hypothetical protein CISIN_1g0091082mg [Citrus sinensis] Length = 300 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38 >KDO59057.1 hypothetical protein CISIN_1g0091082mg [Citrus sinensis] Length = 397 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38 >KDO59056.1 hypothetical protein CISIN_1g0091082mg, partial [Citrus sinensis] Length = 403 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38 >KDO59052.1 hypothetical protein CISIN_1g0091082mg, partial [Citrus sinensis] KDO59053.1 hypothetical protein CISIN_1g0091082mg, partial [Citrus sinensis] KDO59054.1 hypothetical protein CISIN_1g0091082mg, partial [Citrus sinensis] KDO59055.1 hypothetical protein CISIN_1g0091082mg, partial [Citrus sinensis] Length = 415 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38 >XP_006430747.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] ESR43987.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] Length = 421 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38 >XP_006482229.1 PREDICTED: plastidic glucose transporter 4 [Citrus sinensis] XP_006482230.1 PREDICTED: plastidic glucose transporter 4 [Citrus sinensis] XP_006482231.1 PREDICTED: plastidic glucose transporter 4 [Citrus sinensis] Length = 543 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38 >XP_006430744.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] XP_006430745.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] XP_006430746.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] ESR43984.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] ESR43985.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] ESR43986.1 hypothetical protein CICLE_v10011430mg [Citrus clementina] Length = 543 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +3 Query: 225 MQASTYAVKANVCFDARN--RSVLSAGGFAKTRSVALN 332 MQASTYA+KA+VCFDARN R+ + A GFA TRSVALN Sbjct: 1 MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALN 38