BLASTX nr result
ID: Phellodendron21_contig00045833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045833 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015380661.1 PREDICTED: glycine-rich cell wall structural prot... 83 1e-17 XP_015380660.1 PREDICTED: glycine-rich cell wall structural prot... 84 2e-17 XP_019076765.1 PREDICTED: glycine-rich cell wall structural prot... 52 5e-06 XP_010652256.1 PREDICTED: glycine-rich cell wall structural prot... 52 6e-06 XP_010652254.1 PREDICTED: glycine-rich cell wall structural prot... 52 6e-06 >XP_015380661.1 PREDICTED: glycine-rich cell wall structural protein-like [Citrus sinensis] Length = 242 Score = 83.2 bits (204), Expect = 1e-17 Identities = 40/64 (62%), Positives = 50/64 (78%), Gaps = 2/64 (3%) Frame = -1 Query: 188 MGTILRNVGVYAMALFMLMAVVGIAKGRRIEKESMAIHKDHGGAIGRC--NTSSIGDNKW 15 M LRNVG+YA+ LFML+AVVGI +GR+IEKESM +HKD+G AI RC N + +GD+K Sbjct: 1 MAAFLRNVGMYAITLFMLIAVVGITEGRQIEKESMTMHKDNGDAIARCINNGAEVGDSKL 60 Query: 14 GCDR 3 GC R Sbjct: 61 GCGR 64 >XP_015380660.1 PREDICTED: glycine-rich cell wall structural protein-like [Citrus sinensis] Length = 308 Score = 84.0 bits (206), Expect = 2e-17 Identities = 43/68 (63%), Positives = 50/68 (73%), Gaps = 9/68 (13%) Frame = -1 Query: 188 MGTILRNVGVYAMALFMLMAVVGIAKGRRIEKESMAIHKDHGGAIGRCNT---------S 36 M T LRNVG+YA+ LFML+AVVGI +GRRIEKESM +HKDHGGAI C T S Sbjct: 1 MATFLRNVGMYAITLFMLIAVVGITEGRRIEKESMTMHKDHGGAIAPCTTDGAGVGVAAS 60 Query: 35 SIGDNKWG 12 +IGD+K G Sbjct: 61 AIGDSKCG 68 >XP_019076765.1 PREDICTED: glycine-rich cell wall structural protein isoform X3 [Vitis vinifera] Length = 233 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -1 Query: 188 MGTILRNVGVYAMALFMLMAVVGIAKGRRIEKESMAIHKDHGGAIG 51 MG L+NVGV MA+ M+M VVGIA+GRRIEK++ + GG +G Sbjct: 1 MGKFLKNVGVSVMAVLMVMVVVGIAEGRRIEKDTFGENGGGGGGLG 46 >XP_010652256.1 PREDICTED: glycine-rich cell wall structural protein isoform X2 [Vitis vinifera] Length = 259 Score = 52.4 bits (124), Expect = 6e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -1 Query: 188 MGTILRNVGVYAMALFMLMAVVGIAKGRRIEKESMAIHKDHGGAIG 51 MG L+NVGV MA+ M+M VVGIA+GRRIEK++ + GG +G Sbjct: 1 MGKFLKNVGVSVMAVLMVMVVVGIAEGRRIEKDTFGENGGGGGGLG 46 >XP_010652254.1 PREDICTED: glycine-rich cell wall structural protein isoform X1 [Vitis vinifera] Length = 275 Score = 52.4 bits (124), Expect = 6e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -1 Query: 188 MGTILRNVGVYAMALFMLMAVVGIAKGRRIEKESMAIHKDHGGAIG 51 MG L+NVGV MA+ M+M VVGIA+GRRIEK++ + GG +G Sbjct: 1 MGKFLKNVGVSVMAVLMVMVVVGIAEGRRIEKDTFGENGGGGGGLG 46