BLASTX nr result
ID: Phellodendron21_contig00045771
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045771 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006474613.1 PREDICTED: uncharacterized protein LOC102626092 [... 69 8e-12 >XP_006474613.1 PREDICTED: uncharacterized protein LOC102626092 [Citrus sinensis] Length = 321 Score = 68.9 bits (167), Expect = 8e-12 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = -3 Query: 275 EKKITRQPLKTKHQAEKVAPKPSPKNQSNES*RKEAPTTT----YHITWHRFEESEEEPL 108 ++KITRQ +K K QAEKV PKP PKN +N+ +K PT+T YHI W FEESEEE L Sbjct: 185 KEKITRQSVKKKQQAEKVTPKPGPKNHTNKPSKKGNPTSTSPPRYHIFWDGFEESEEEAL 244