BLASTX nr result
ID: Phellodendron21_contig00045737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045737 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005650700.1 PsaL-domain-containing protein [Coccomyxa subelli... 152 1e-44 XP_003060103.1 photosystem I subunit XI, chloroplast precursor [... 142 6e-41 XP_002504254.1 photosystem I subunit XI, chloroplast precursor [... 139 2e-39 XP_005844020.1 hypothetical protein CHLNCDRAFT_32796 [Chlorella ... 135 4e-38 XP_001416150.1 photosystem I subunit XI precursor [Ostreococcus ... 134 2e-37 XP_003074802.1 PsaL photosystem I subunit XI precursor (IC) [Ost... 130 3e-36 CEG00928.1 Photosystem I PsaL, reaction centre subunit XI [Ostre... 130 4e-36 OAY34894.1 hypothetical protein MANES_12G055600 [Manihot esculenta] 130 7e-36 XP_012084555.1 PREDICTED: photosystem I reaction center subunit ... 129 1e-35 XP_017237958.1 PREDICTED: photosystem I reaction center subunit ... 129 2e-35 XP_009415117.1 PREDICTED: photosystem I reaction center subunit ... 129 2e-35 XP_009405532.1 PREDICTED: photosystem I reaction center subunit ... 129 2e-35 XP_006414990.1 hypothetical protein EUTSA_v10026195mg [Eutrema s... 128 3e-35 XP_019462041.1 PREDICTED: photosystem I reaction center subunit ... 128 4e-35 XP_017249068.1 PREDICTED: photosystem I reaction center subunit ... 128 4e-35 XP_010095590.1 Photosystem I reaction center subunit XI [Morus n... 128 5e-35 ABK55685.1 PsaL, partial [Cucumis sativus] 126 5e-35 XP_019431234.1 PREDICTED: photosystem I reaction center subunit ... 127 5e-35 XP_002320562.1 Photosystem I reaction center subunit XI family p... 127 6e-35 KDO43506.1 hypothetical protein CISIN_1g027843mg [Citrus sinensis] 127 6e-35 >XP_005650700.1 PsaL-domain-containing protein [Coccomyxa subellipsoidea C-169] EIE26156.1 PsaL-domain-containing protein [Coccomyxa subellipsoidea C-169] Length = 210 Score = 152 bits (384), Expect = 1e-44 Identities = 73/99 (73%), Positives = 87/99 (87%), Gaps = 1/99 (1%) Frame = -1 Query: 298 KANLGSVAGLTPATKSRVGRSGLIIRA-EKPQVVQPINGDPFIGMLETPVTSSPLVANFL 122 +++LG++AGLTP +R R+ +++RA +K QV+QPINGDPFIGMLETPVTSSPLVA FL Sbjct: 23 RSSLGNIAGLTPVFHARQNRAAVVVRAADKQQVIQPINGDPFIGMLETPVTSSPLVAGFL 82 Query: 121 SNLPAYRTGVSPLLRGVEVGLAHGLLLTGPFIKLGPLRN 5 SNLPAYR GVSPLLRGVE+GL HG L+TGPFIKLGPLRN Sbjct: 83 SNLPAYRIGVSPLLRGVEIGLVHGFLVTGPFIKLGPLRN 121 >XP_003060103.1 photosystem I subunit XI, chloroplast precursor [Micromonas pusilla CCMP1545] EEH56055.1 photosystem I subunit XI, chloroplast precursor [Micromonas pusilla CCMP1545] Length = 206 Score = 142 bits (359), Expect = 6e-41 Identities = 74/103 (71%), Positives = 86/103 (83%), Gaps = 3/103 (2%) Frame = -1 Query: 301 RKANLGS-VAGLTPATKSRVGRSGLIIRA--EKPQVVQPINGDPFIGMLETPVTSSPLVA 131 R++ LG V+GL PA R ++ +++RA EK QV++PINGDPFIGMLETPVTS+P+VA Sbjct: 21 RRSFLGKGVSGLAPA---RAAKASVVVRAAAEKAQVIKPINGDPFIGMLETPVTSAPIVA 77 Query: 130 NFLSNLPAYRTGVSPLLRGVEVGLAHGLLLTGPFIKLGPLRNT 2 NFLSNLPAYRTGVSPL RGVEVGLAHG LTGPFIKLGPLR T Sbjct: 78 NFLSNLPAYRTGVSPLTRGVEVGLAHGFFLTGPFIKLGPLRGT 120 >XP_002504254.1 photosystem I subunit XI, chloroplast precursor [Micromonas commoda] ACO65512.1 photosystem I subunit XI, chloroplast precursor [Micromonas commoda] Length = 206 Score = 139 bits (349), Expect = 2e-39 Identities = 75/104 (72%), Positives = 85/104 (81%), Gaps = 4/104 (3%) Frame = -1 Query: 301 RKANLGS-VAGLTP---ATKSRVGRSGLIIRAEKPQVVQPINGDPFIGMLETPVTSSPLV 134 R++ LG VAGL P A +S V R+ AEK QV++P+NGDPFIGMLETPVTS+P+V Sbjct: 21 RRSFLGKGVAGLAPVRPAVRSVVVRAA----AEKAQVIKPLNGDPFIGMLETPVTSAPIV 76 Query: 133 ANFLSNLPAYRTGVSPLLRGVEVGLAHGLLLTGPFIKLGPLRNT 2 ANFLSNLPAYRTGVSPL RGVEVGLAHG LTGPFIKLGPLR+T Sbjct: 77 ANFLSNLPAYRTGVSPLTRGVEVGLAHGFFLTGPFIKLGPLRST 120 >XP_005844020.1 hypothetical protein CHLNCDRAFT_32796 [Chlorella variabilis] EFN51918.1 hypothetical protein CHLNCDRAFT_32796 [Chlorella variabilis] Length = 194 Score = 135 bits (339), Expect = 4e-38 Identities = 69/89 (77%), Positives = 76/89 (85%) Frame = -1 Query: 271 LTPATKSRVGRSGLIIRAEKPQVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGV 92 LT A ++RV + + A+K QV+QP+NGDPFIGMLETPVTSSPLVA FLSNLPAYRTGV Sbjct: 18 LTSARRARVV-APVRAMADKAQVIQPVNGDPFIGMLETPVTSSPLVAGFLSNLPAYRTGV 76 Query: 91 SPLLRGVEVGLAHGLLLTGPFIKLGPLRN 5 PLLRGVEVGLAHG LL GPFIKLGPLRN Sbjct: 77 PPLLRGVEVGLAHGFLLVGPFIKLGPLRN 105 >XP_001416150.1 photosystem I subunit XI precursor [Ostreococcus lucimarinus CCE9901] ABO94443.1 photosystem I subunit XI precursor [Ostreococcus lucimarinus CCE9901] Length = 209 Score = 134 bits (336), Expect = 2e-37 Identities = 64/80 (80%), Positives = 73/80 (91%) Frame = -1 Query: 241 RSGLIIRAEKPQVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVG 62 RS ++ ++K Q+++PINGDPFIGMLETPVTSSP VANFLSNLPAYRTGV+PLLRGVEVG Sbjct: 44 RSVVLASSDKVQIIKPINGDPFIGMLETPVTSSPDVANFLSNLPAYRTGVAPLLRGVEVG 103 Query: 61 LAHGLLLTGPFIKLGPLRNT 2 LAHG LTGPFIKLGPLR+T Sbjct: 104 LAHGFFLTGPFIKLGPLRST 123 >XP_003074802.1 PsaL photosystem I subunit XI precursor (IC) [Ostreococcus tauri] Length = 202 Score = 130 bits (327), Expect = 3e-36 Identities = 62/73 (84%), Positives = 69/73 (94%) Frame = -1 Query: 220 AEKPQVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAHGLLL 41 ++K Q+V+PINGDPFIGMLETPVTSSP VANFLSNLPAYRTGV+PLLRGVEVGLAHG + Sbjct: 44 SDKVQIVKPINGDPFIGMLETPVTSSPDVANFLSNLPAYRTGVAPLLRGVEVGLAHGFFV 103 Query: 40 TGPFIKLGPLRNT 2 TGPFIKLGPLR+T Sbjct: 104 TGPFIKLGPLRST 116 >CEG00928.1 Photosystem I PsaL, reaction centre subunit XI [Ostreococcus tauri] Length = 204 Score = 130 bits (327), Expect = 4e-36 Identities = 62/73 (84%), Positives = 69/73 (94%) Frame = -1 Query: 220 AEKPQVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAHGLLL 41 ++K Q+V+PINGDPFIGMLETPVTSSP VANFLSNLPAYRTGV+PLLRGVEVGLAHG + Sbjct: 46 SDKVQIVKPINGDPFIGMLETPVTSSPDVANFLSNLPAYRTGVAPLLRGVEVGLAHGFFV 105 Query: 40 TGPFIKLGPLRNT 2 TGPFIKLGPLR+T Sbjct: 106 TGPFIKLGPLRST 118 >OAY34894.1 hypothetical protein MANES_12G055600 [Manihot esculenta] Length = 214 Score = 130 bits (326), Expect = 7e-36 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 2/97 (2%) Frame = -1 Query: 286 GSVAGLTPATKSRVGRSGLIIRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNL 113 G+ ++P +S R+ I++EKP QV+QPINGDPFIG LETPVTSSPL+A +LSNL Sbjct: 30 GAPFRVSPTRRSFTVRA---IQSEKPTFQVIQPINGDPFIGSLETPVTSSPLIAWYLSNL 86 Query: 112 PAYRTGVSPLLRGVEVGLAHGLLLTGPFIKLGPLRNT 2 PAYRT VSPLLRGVEVGLAHGLLL GPF+K GPLRNT Sbjct: 87 PAYRTAVSPLLRGVEVGLAHGLLLVGPFVKAGPLRNT 123 >XP_012084555.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic [Jatropha curcas] KDP45210.1 hypothetical protein JCGZ_15075 [Jatropha curcas] Length = 219 Score = 129 bits (325), Expect = 1e-35 Identities = 64/77 (83%), Positives = 70/77 (90%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I++EKP QV+QPINGDPFIG LETPVTSSPL+A +LSNLPAYRT VSPLLRGVEVGLAH Sbjct: 52 IQSEKPTFQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAH 111 Query: 52 GLLLTGPFIKLGPLRNT 2 GLLL GPF+K GPLRNT Sbjct: 112 GLLLVGPFVKAGPLRNT 128 >XP_017237958.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic [Daucus carota subsp. sativus] KZN03948.1 hypothetical protein DCAR_012704 [Daucus carota subsp. sativus] Length = 219 Score = 129 bits (324), Expect = 2e-35 Identities = 63/77 (81%), Positives = 70/77 (90%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 ++AEKP QV+QPINGDPFIG LETPVTSSPL+A +LSNLPAYRT V+PLLRGVEVGLAH Sbjct: 52 VQAEKPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAH 111 Query: 52 GLLLTGPFIKLGPLRNT 2 GLLL GPF+K GPLRNT Sbjct: 112 GLLLVGPFVKAGPLRNT 128 >XP_009415117.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 219 Score = 129 bits (324), Expect = 2e-35 Identities = 65/77 (84%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I+AEKP QV+QPINGDPFIG LETPVTSSPLVA +LSNLPAYRT VSPLLRGVEVGLAH Sbjct: 52 IQAEKPTYQVIQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAH 111 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 112 GYLLVGPFVKAGPLRNT 128 >XP_009405532.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 221 Score = 129 bits (323), Expect = 2e-35 Identities = 64/77 (83%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I+AEKP QV+QPINGDPFIG LETPVTSSPL+A +LSNLPAYRT VSPLLRGVEVGLAH Sbjct: 54 IQAEKPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAH 113 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 114 GYLLVGPFVKAGPLRNT 130 >XP_006414990.1 hypothetical protein EUTSA_v10026195mg [Eutrema salsugineum] ESQ56443.1 hypothetical protein EUTSA_v10026195mg [Eutrema salsugineum] Length = 219 Score = 128 bits (322), Expect = 3e-35 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%) Frame = -1 Query: 286 GSVAGLTPATKSRVGRSGLIIRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNL 113 G+ G++P TK + ++A+KP QV+QPINGDPFIG LETPVTSSPL+A +LSNL Sbjct: 33 GAPFGVSP-TKRTSSLTVRAVQADKPTFQVIQPINGDPFIGSLETPVTSSPLIAWYLSNL 91 Query: 112 PAYRTGVSPLLRGVEVGLAHGLLLTGPFIKLGPLRNT 2 PAYRT V+PLLRGVEVGLAHG LL GPF+K GPLRNT Sbjct: 92 PAYRTAVNPLLRGVEVGLAHGFLLVGPFVKAGPLRNT 128 >XP_019462041.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like [Lupinus angustifolius] OIW01141.1 hypothetical protein TanjilG_25249 [Lupinus angustifolius] Length = 214 Score = 128 bits (321), Expect = 4e-35 Identities = 63/77 (81%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I++EKP QV+QPINGDPFIG LETPVTSSPLVA +LSNLPAYRT VSPLLRG+EVGLAH Sbjct: 47 IQSEKPTFQVIQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAH 106 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 107 GFLLVGPFVKAGPLRNT 123 >XP_017249068.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like [Daucus carota subsp. sativus] KZM95368.1 hypothetical protein DCAR_018610 [Daucus carota subsp. sativus] Length = 218 Score = 128 bits (321), Expect = 4e-35 Identities = 62/77 (80%), Positives = 70/77 (90%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 ++A+KP QV+QPINGDPFIG LETPVTSSPL+A +LSNLPAYRT V+PLLRGVEVGLAH Sbjct: 51 VQADKPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLAH 110 Query: 52 GLLLTGPFIKLGPLRNT 2 GLLL GPF+K GPLRNT Sbjct: 111 GLLLVGPFVKAGPLRNT 127 >XP_010095590.1 Photosystem I reaction center subunit XI [Morus notabilis] EXB61163.1 Photosystem I reaction center subunit XI [Morus notabilis] Length = 224 Score = 128 bits (321), Expect = 5e-35 Identities = 63/77 (81%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I++EKP QV+QPINGDPFIG LETPVTSSPL+A +LSNLPAYRT VSPLLRGVEVGLAH Sbjct: 57 IQSEKPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAH 116 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 117 GFLLVGPFVKTGPLRNT 133 >ABK55685.1 PsaL, partial [Cucumis sativus] Length = 163 Score = 126 bits (316), Expect = 5e-35 Identities = 61/77 (79%), Positives = 68/77 (88%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I+A+KP QV+QPINGDPFIG LETPVTSSPL+A +LSNLPAYRT VSPLLRG+EVGLAH Sbjct: 7 IQADKPTFQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAH 66 Query: 52 GLLLTGPFIKLGPLRNT 2 G L GPF+K GPLRNT Sbjct: 67 GFFLVGPFVKAGPLRNT 83 >XP_019431234.1 PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like [Lupinus angustifolius] OIW20527.1 hypothetical protein TanjilG_14056 [Lupinus angustifolius] Length = 214 Score = 127 bits (320), Expect = 5e-35 Identities = 63/77 (81%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I++EKP QV+QPINGDPFIG LETPVTSSPLVA +LSNLPAYRT VSPLLRG+EVGLAH Sbjct: 47 IQSEKPTFQVIQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAH 106 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 107 GYLLVGPFVKAGPLRNT 123 >XP_002320562.1 Photosystem I reaction center subunit XI family protein [Populus trichocarpa] ABK95404.1 unknown [Populus trichocarpa] ABK96038.1 unknown [Populus trichocarpa] EEE98877.1 Photosystem I reaction center subunit XI family protein [Populus trichocarpa] Length = 216 Score = 127 bits (320), Expect = 6e-35 Identities = 62/77 (80%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 ++A+KP QVVQPINGDPFIG LETPVTSSPL+A +LSNLPAYRT VSPLLRG+EVGLAH Sbjct: 49 VQADKPTYQVVQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAH 108 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 109 GFLLVGPFVKAGPLRNT 125 >KDO43506.1 hypothetical protein CISIN_1g027843mg [Citrus sinensis] Length = 218 Score = 127 bits (320), Expect = 6e-35 Identities = 62/77 (80%), Positives = 69/77 (89%), Gaps = 2/77 (2%) Frame = -1 Query: 226 IRAEKP--QVVQPINGDPFIGMLETPVTSSPLVANFLSNLPAYRTGVSPLLRGVEVGLAH 53 I++EKP QV+QPINGDPFIG LETP+TSSPL+A +LSNLPAYRT VSPLLRGVEVGLAH Sbjct: 51 IQSEKPTYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAH 110 Query: 52 GLLLTGPFIKLGPLRNT 2 G LL GPF+K GPLRNT Sbjct: 111 GFLLVGPFVKAGPLRNT 127