BLASTX nr result
ID: Phellodendron21_contig00045651
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045651 (599 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO70215.1 hypothetical protein CISIN_1g037894mg [Citrus sinensis] 55 4e-07 >KDO70215.1 hypothetical protein CISIN_1g037894mg [Citrus sinensis] Length = 72 Score = 55.5 bits (132), Expect = 4e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +2 Query: 56 KCAPKFIVCYYVLIFQAIRAWCDINLFLCSF 148 K APKF V Y VLIFQAIRAWCDI LFLCSF Sbjct: 42 KHAPKFRVWYVVLIFQAIRAWCDIKLFLCSF 72