BLASTX nr result
ID: Phellodendron21_contig00045583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045583 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO85513.1 hypothetical protein CISIN_1g018210mg [Citrus sinensis] 61 1e-08 XP_006464427.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 61 1e-08 XP_006445429.1 hypothetical protein CICLE_v10021096mg [Citrus cl... 61 1e-08 KDO85515.1 hypothetical protein CISIN_1g018210mg [Citrus sinensis] 61 1e-08 XP_016725556.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 57 2e-08 XP_011032047.1 PREDICTED: leucine carboxyl methyltransferase 1 i... 58 1e-07 XP_011032040.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 58 1e-07 XP_006375134.1 hypothetical protein POPTR_0014s04660g [Populus t... 57 4e-07 XP_012083696.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 55 2e-06 XP_002511586.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 54 3e-06 KOM49850.1 hypothetical protein LR48_Vigan08g067700 [Vigna angul... 54 4e-06 XP_017433176.1 PREDICTED: leucine carboxyl methyltransferase 1 i... 54 5e-06 KRH01069.1 hypothetical protein GLYMA_18G252000 [Glycine max] 53 5e-06 XP_017433175.1 PREDICTED: leucine carboxyl methyltransferase 1 i... 54 5e-06 XP_017433174.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 54 5e-06 KRH01070.1 hypothetical protein GLYMA_18G252000 [Glycine max] 53 6e-06 XP_006602875.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 53 7e-06 KHN40554.1 Leucine carboxyl methyltransferase 2 [Glycine soja] 53 7e-06 XP_003551714.1 PREDICTED: tRNA wybutosine-synthesizing protein 4... 53 7e-06 >KDO85513.1 hypothetical protein CISIN_1g018210mg [Citrus sinensis] Length = 313 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLDC SD D++C TKKQILS G GFDTTYFQLQ Sbjct: 69 LYQFLDCGSDGDKKCHTKKQILSLGAGFDTTYFQLQ 104 >XP_006464427.1 PREDICTED: tRNA wybutosine-synthesizing protein 4 isoform X2 [Citrus sinensis] KDO85512.1 hypothetical protein CISIN_1g018210mg [Citrus sinensis] Length = 325 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLDC SD D++C TKKQILS G GFDTTYFQLQ Sbjct: 69 LYQFLDCGSDGDKKCHTKKQILSLGAGFDTTYFQLQ 104 >XP_006445429.1 hypothetical protein CICLE_v10021096mg [Citrus clementina] XP_006464426.1 PREDICTED: tRNA wybutosine-synthesizing protein 4 isoform X1 [Citrus sinensis] ESR58669.1 hypothetical protein CICLE_v10021096mg [Citrus clementina] KDO85514.1 hypothetical protein CISIN_1g018210mg [Citrus sinensis] Length = 329 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLDC SD D++C TKKQILS G GFDTTYFQLQ Sbjct: 69 LYQFLDCGSDGDKKCHTKKQILSLGAGFDTTYFQLQ 104 >KDO85515.1 hypothetical protein CISIN_1g018210mg [Citrus sinensis] Length = 359 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLDC SD D++C TKKQILS G GFDTTYFQLQ Sbjct: 69 LYQFLDCGSDGDKKCHTKKQILSLGAGFDTTYFQLQ 104 >XP_016725556.1 PREDICTED: tRNA wybutosine-synthesizing protein 4-like [Gossypium hirsutum] Length = 83 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQVLEY 272 +Y FLDCE + + TK+QILS G GFDTTYFQLQVL++ Sbjct: 35 LYQFLDCEGSNSEKGKTKRQILSLGAGFDTTYFQLQVLDF 74 >XP_011032047.1 PREDICTED: leucine carboxyl methyltransferase 1 isoform X2 [Populus euphratica] Length = 281 Score = 58.2 bits (139), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 162 FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 FLDCES+ D +C TKKQILSFG GFDT YFQLQ Sbjct: 73 FLDCESNIDGKCDTKKQILSFGAGFDTMYFQLQ 105 >XP_011032040.1 PREDICTED: tRNA wybutosine-synthesizing protein 4 isoform X1 [Populus euphratica] Length = 344 Score = 58.2 bits (139), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 162 FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 FLDCES+ D +C TKKQILSFG GFDT YFQLQ Sbjct: 73 FLDCESNIDGKCDTKKQILSFGAGFDTMYFQLQ 105 >XP_006375134.1 hypothetical protein POPTR_0014s04660g [Populus trichocarpa] ERP52931.1 hypothetical protein POPTR_0014s04660g [Populus trichocarpa] Length = 344 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 162 FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 FLDCES+ D +C +KKQILSFG GFDT YFQLQ Sbjct: 73 FLDCESNIDGKCDSKKQILSFGAGFDTMYFQLQ 105 >XP_012083696.1 PREDICTED: tRNA wybutosine-synthesizing protein 4 [Jatropha curcas] KDP28857.1 hypothetical protein JCGZ_14628 [Jatropha curcas] Length = 342 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLDCE ++D + TKKQILS G GFDTTYFQLQ Sbjct: 69 LYQFLDCEMNADEKGHTKKQILSIGAGFDTTYFQLQ 104 >XP_002511586.1 PREDICTED: tRNA wybutosine-synthesizing protein 4 [Ricinus communis] EEF50255.1 leucine carboxyl methyltransferase, putative [Ricinus communis] Length = 346 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLDCE + D + TKKQILS G GFDTTYFQLQ Sbjct: 69 MYQFLDCEMNGDEKGHTKKQILSIGAGFDTTYFQLQ 104 >KOM49850.1 hypothetical protein LR48_Vigan08g067700 [Vigna angularis] Length = 240 Score = 53.5 bits (127), Expect = 4e-06 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ--------VLEYPFKAPPSLHICV 308 +Y FLD E +D + P KKQILS G GFDTTYFQLQ +E FK S + Sbjct: 68 LYQFLDIEKKADGDAPIKKQILSLGAGFDTTYFQLQDEGKAPDLYVEVDFKEVTSKKAAL 127 Query: 309 SCHNSSLK 332 NS LK Sbjct: 128 IETNSQLK 135 >XP_017433176.1 PREDICTED: leucine carboxyl methyltransferase 1 isoform X3 [Vigna angularis] Length = 275 Score = 53.5 bits (127), Expect = 5e-06 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ--------VLEYPFKAPPSLHICV 308 +Y FLD E +D + P KKQILS G GFDTTYFQLQ +E FK S + Sbjct: 68 LYQFLDIEKKADGDAPIKKQILSLGAGFDTTYFQLQDEGKAPDLYVEVDFKEVTSKKAAL 127 Query: 309 SCHNSSLK 332 NS LK Sbjct: 128 IETNSQLK 135 >KRH01069.1 hypothetical protein GLYMA_18G252000 [Glycine max] Length = 237 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLD E SD + P KKQILS G GFDTTYFQLQ Sbjct: 65 LYQFLDVEKKSDEDPPIKKQILSLGAGFDTTYFQLQ 100 >XP_017433175.1 PREDICTED: leucine carboxyl methyltransferase 1 isoform X2 [Vigna angularis] Length = 334 Score = 53.5 bits (127), Expect = 5e-06 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ--------VLEYPFKAPPSLHICV 308 +Y FLD E +D + P KKQILS G GFDTTYFQLQ +E FK S + Sbjct: 68 LYQFLDIEKKADGDAPIKKQILSLGAGFDTTYFQLQDEGKAPDLYVEVDFKEVTSKKAAL 127 Query: 309 SCHNSSLK 332 NS LK Sbjct: 128 IETNSQLK 135 >XP_017433174.1 PREDICTED: tRNA wybutosine-synthesizing protein 4 isoform X1 [Vigna angularis] BAT89847.1 hypothetical protein VIGAN_06094800 [Vigna angularis var. angularis] Length = 334 Score = 53.5 bits (127), Expect = 5e-06 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ--------VLEYPFKAPPSLHICV 308 +Y FLD E +D + P KKQILS G GFDTTYFQLQ +E FK S + Sbjct: 68 LYQFLDIEKKADGDAPIKKQILSLGAGFDTTYFQLQDEGKAPDLYVEVDFKEVTSKKAAL 127 Query: 309 SCHNSSLK 332 NS LK Sbjct: 128 IETNSQLK 135 >KRH01070.1 hypothetical protein GLYMA_18G252000 [Glycine max] Length = 258 Score = 53.1 bits (126), Expect = 6e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLD E SD + P KKQILS G GFDTTYFQLQ Sbjct: 65 LYQFLDVEKKSDEDPPIKKQILSLGAGFDTTYFQLQ 100 >XP_006602875.1 PREDICTED: tRNA wybutosine-synthesizing protein 4-like isoform X2 [Glycine max] KRH01067.1 hypothetical protein GLYMA_18G252000 [Glycine max] Length = 317 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLD E SD + P KKQILS G GFDTTYFQLQ Sbjct: 65 LYQFLDVEKKSDEDPPIKKQILSLGAGFDTTYFQLQ 100 >KHN40554.1 Leucine carboxyl methyltransferase 2 [Glycine soja] Length = 321 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLD E SD + P KKQILS G GFDTTYFQLQ Sbjct: 65 LYQFLDVEKKSDEDPPIKKQILSLGAGFDTTYFQLQ 100 >XP_003551714.1 PREDICTED: tRNA wybutosine-synthesizing protein 4-like isoform X1 [Glycine max] KRH01068.1 hypothetical protein GLYMA_18G252000 [Glycine max] Length = 332 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 153 VY*FLDCESDSDRECPTKKQILSFGVGFDTTYFQLQ 260 +Y FLD E SD + P KKQILS G GFDTTYFQLQ Sbjct: 65 LYQFLDVEKKSDEDPPIKKQILSLGAGFDTTYFQLQ 100