BLASTX nr result
ID: Phellodendron21_contig00045574
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045574 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005648929.1 thiazole biosynthetic enzyme [Coccomyxa subellips... 57 1e-07 >XP_005648929.1 thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169] EIE24385.1 thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169] Length = 317 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 292 GPTFGAMFMSGQKAAHCALNSLNRQKALNQ 203 GPTFGAMFMSGQKAAHCALNSL RQ AL++ Sbjct: 272 GPTFGAMFMSGQKAAHCALNSLRRQNALDK 301