BLASTX nr result
ID: Phellodendron21_contig00045544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045544 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EME45838.1 hypothetical protein DOTSEDRAFT_71512 [Dothistroma se... 66 3e-10 EZF16293.1 hypothetical protein H100_05755 [Trichophyton rubrum ... 64 1e-09 XP_003020324.1 hypothetical protein TRV_05580 [Trichophyton verr... 64 1e-09 XP_003016604.1 hypothetical protein ARB_04893 [Trichophyton benh... 64 1e-09 OAL72339.1 eukaryotic translation initiation factor 5 [Trichophy... 64 1e-09 XP_003236408.1 eukaryotic translation initiation factor 5 [Trich... 64 1e-09 DAA78773.1 TPA_exp: Uncharacterized protein A8136_2558 [Trichoph... 64 1e-09 EGD93608.1 eukaryotic translation initiation factor 5 [Trichophy... 64 1e-09 GAM88864.1 hypothetical protein ANO11243_068980 [fungal sp. No.1... 64 2e-09 XP_007783632.1 translation initiation factor eIF-5 [Coniosporium... 64 2e-09 KEQ58250.1 hypothetical protein M437DRAFT_59829 [Aureobasidium m... 64 2e-09 XP_003174667.1 eukaryotic translation initiation factor 5 [Nanni... 64 2e-09 KXL49050.1 hypothetical protein FE78DRAFT_86550 [Acidomyces rich... 64 2e-09 OJD17681.1 hypothetical protein AJ78_02272 [Emmonsia pasteuriana... 63 4e-09 EER45796.1 eukaryotic translation initiation factor 5 [Histoplas... 62 4e-09 XP_001537881.1 eukaryotic translation initiation factor 5 [Histo... 62 5e-09 XP_003853842.1 hypothetical protein MYCGRDRAFT_108627 [Zymosepto... 62 5e-09 OJD26630.1 hypothetical protein ACJ73_01981 [Blastomyces sp. CAC... 62 5e-09 EEH07643.1 eukaryotic translation initiation factor 5 [Histoplas... 62 5e-09 EGC41741.1 eukaryotic translation initiation factor 5 [Histoplas... 62 5e-09 >EME45838.1 hypothetical protein DOTSEDRAFT_71512 [Dothistroma septosporum NZE10] Length = 428 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WGGKASKKYVDIATS+KVRKSAEKFIEWL Sbjct: 384 LKAWGGKASKKYVDIATSRKVRKSAEKFIEWL 415 >EZF16293.1 hypothetical protein H100_05755 [Trichophyton rubrum MR850] EZF40429.1 hypothetical protein H102_05723 [Trichophyton rubrum CBS 100081] EZF50937.1 hypothetical protein H103_05751 [Trichophyton rubrum CBS 288.86] EZF61652.1 hypothetical protein H104_05735 [Trichophyton rubrum CBS 289.86] EZF72193.1 hypothetical protein H105_05763 [Trichophyton soudanense CBS 452.61] EZF82763.1 hypothetical protein H110_05744 [Trichophyton rubrum MR1448] EZF93622.1 hypothetical protein H113_05792 [Trichophyton rubrum MR1459] EZG04700.1 hypothetical protein H106_05586 [Trichophyton rubrum CBS 735.88] EZG15238.1 hypothetical protein H107_05887 [Trichophyton rubrum CBS 202.88] KDB32157.1 hypothetical protein H112_05738 [Trichophyton rubrum D6] KFL61204.1 hypothetical protein TERG_03453 [Trichophyton rubrum CBS 118892] Length = 415 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 371 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 402 >XP_003020324.1 hypothetical protein TRV_05580 [Trichophyton verrucosum HKI 0517] EFE39706.1 hypothetical protein TRV_05580 [Trichophyton verrucosum HKI 0517] Length = 416 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 371 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 402 >XP_003016604.1 hypothetical protein ARB_04893 [Trichophyton benhamiae CBS 112371] EFE35959.1 hypothetical protein ARB_04893 [Trichophyton benhamiae CBS 112371] Length = 416 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 371 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 402 >OAL72339.1 eukaryotic translation initiation factor 5 [Trichophyton violaceum] Length = 433 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 389 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 420 >XP_003236408.1 eukaryotic translation initiation factor 5 [Trichophyton rubrum CBS 118892] EGD87203.1 hypothetical protein TERG_03453 [Trichophyton rubrum CBS 118892] EZF16292.1 hypothetical protein H100_05755 [Trichophyton rubrum MR850] EZF40428.1 hypothetical protein H102_05723 [Trichophyton rubrum CBS 100081] EZF50936.1 hypothetical protein H103_05751 [Trichophyton rubrum CBS 288.86] EZF61651.1 hypothetical protein H104_05735 [Trichophyton rubrum CBS 289.86] EZF72192.1 hypothetical protein H105_05763 [Trichophyton soudanense CBS 452.61] EZF82762.1 hypothetical protein H110_05744 [Trichophyton rubrum MR1448] EZF93621.1 hypothetical protein H113_05792 [Trichophyton rubrum MR1459] EZG04699.1 hypothetical protein H106_05586 [Trichophyton rubrum CBS 735.88] EZG15237.1 hypothetical protein H107_05887 [Trichophyton rubrum CBS 202.88] KDB32156.1 hypothetical protein H112_05738 [Trichophyton rubrum D6] KMQ49195.1 Translation initiation factor IF2/IF5 [Trichophyton rubrum] OAL62271.1 eukaryotic translation initiation factor 5 [Trichophyton rubrum] Length = 433 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 389 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 420 >DAA78773.1 TPA_exp: Uncharacterized protein A8136_2558 [Trichophyton benhamiae CBS 112371] Length = 434 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 389 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 420 >EGD93608.1 eukaryotic translation initiation factor 5 [Trichophyton tonsurans CBS 112818] EZF29344.1 hypothetical protein H101_06978 [Trichophyton interdigitale H6] KDB24028.1 hypothetical protein H109_04135 [Trichophyton interdigitale MR816] Length = 434 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATSKKVRKSAEKF+EWL Sbjct: 389 LKSWGTKASKKYVDIATSKKVRKSAEKFLEWL 420 >GAM88864.1 hypothetical protein ANO11243_068980 [fungal sp. No.11243] Length = 422 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATSKKVRKSAEKFIEWL Sbjct: 380 LKAWGTKASKKYVDIATSKKVRKSAEKFIEWL 411 >XP_007783632.1 translation initiation factor eIF-5 [Coniosporium apollinis CBS 100218] EON68315.1 translation initiation factor eIF-5 [Coniosporium apollinis CBS 100218] Length = 424 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVD+ATSKKVRKSAEKFIEWL Sbjct: 381 LKAWGSKASKKYVDLATSKKVRKSAEKFIEWL 412 >KEQ58250.1 hypothetical protein M437DRAFT_59829 [Aureobasidium melanogenum CBS 110374] Length = 428 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVD+ATSKKVRKSAEKFIEWL Sbjct: 380 LKAWGSKASKKYVDLATSKKVRKSAEKFIEWL 411 >XP_003174667.1 eukaryotic translation initiation factor 5 [Nannizzia gypsea CBS 118893] EFQ99184.1 eukaryotic translation initiation factor 5 [Nannizzia gypsea CBS 118893] Length = 431 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATS+KVRKSAEKF+EWL Sbjct: 386 LKSWGSKASKKYVDIATSRKVRKSAEKFLEWL 417 >KXL49050.1 hypothetical protein FE78DRAFT_86550 [Acidomyces richmondensis] KYG41452.1 hypothetical protein M433DRAFT_159014 [Acidomyces richmondensis BFW] Length = 437 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LKSWG KASKKYVDIATS+KVRKSAEKF+EWL Sbjct: 392 LKSWGSKASKKYVDIATSRKVRKSAEKFLEWL 423 >OJD17681.1 hypothetical protein AJ78_02272 [Emmonsia pasteuriana UAMH 9510] Length = 430 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATS+KVRKSAEKF+EWL Sbjct: 386 LKAWGSKASKKYVDIATSRKVRKSAEKFLEWL 417 >EER45796.1 eukaryotic translation initiation factor 5 [Histoplasma capsulatum H143] Length = 312 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATS+KVRK+AEKFIEWL Sbjct: 269 LKAWGSKASKKYVDIATSRKVRKAAEKFIEWL 300 >XP_001537881.1 eukaryotic translation initiation factor 5 [Histoplasma capsulatum NAm1] EDN10842.1 eukaryotic translation initiation factor 5 [Histoplasma capsulatum NAm1] Length = 387 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATS+KVRK+AEKFIEWL Sbjct: 344 LKAWGSKASKKYVDIATSRKVRKAAEKFIEWL 375 >XP_003853842.1 hypothetical protein MYCGRDRAFT_108627 [Zymoseptoria tritici IPO323] EGP88818.1 hypothetical protein MYCGRDRAFT_108627 [Zymoseptoria tritici IPO323] KJY01439.1 eukaryotic translation initiation factor 5 like protein [Zymoseptoria brevis] Length = 427 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 L +WGGKASKKYVDI+TS+KVRKSAEKFIEWL Sbjct: 382 LTAWGGKASKKYVDISTSRKVRKSAEKFIEWL 413 >OJD26630.1 hypothetical protein ACJ73_01981 [Blastomyces sp. CAC-2015b] Length = 429 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATS+KVRK+AEKFIEWL Sbjct: 386 LKAWGSKASKKYVDIATSRKVRKAAEKFIEWL 417 >EEH07643.1 eukaryotic translation initiation factor 5 [Histoplasma capsulatum G186AR] Length = 429 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATS+KVRK+AEKFIEWL Sbjct: 386 LKAWGSKASKKYVDIATSRKVRKAAEKFIEWL 417 >EGC41741.1 eukaryotic translation initiation factor 5 [Histoplasma capsulatum H88] Length = 429 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 355 LKSWGGKASKKYVDIATSKKVRKSAEKFIEWL 260 LK+WG KASKKYVDIATS+KVRK+AEKFIEWL Sbjct: 386 LKAWGSKASKKYVDIATSRKVRKAAEKFIEWL 417