BLASTX nr result
ID: Phellodendron21_contig00045518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045518 (507 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006465374.1 PREDICTED: transcription initiation factor TFIID ... 105 9e-26 XP_006427203.1 hypothetical protein CICLE_v10026703mg [Citrus cl... 105 9e-26 OMP10815.1 Zinc finger, RanBP2-type [Corchorus capsularis] 99 2e-23 OMP00119.1 Zinc finger, RanBP2-type [Corchorus olitorius] 99 2e-23 XP_007023906.1 PREDICTED: TATA-binding protein-associated factor... 99 2e-23 XP_016725716.1 PREDICTED: zinc finger Ran-binding domain-contain... 95 5e-22 XP_017644852.1 PREDICTED: zinc finger Ran-binding domain-contain... 95 5e-22 XP_012452693.1 PREDICTED: zinc finger Ran-binding domain-contain... 95 5e-22 XP_012443263.1 PREDICTED: zinc finger Ran-binding domain-contain... 95 7e-22 XP_010254345.1 PREDICTED: uncharacterized RNA-binding protein C1... 95 1e-21 XP_002299606.1 zinc finger family protein [Populus trichocarpa] ... 95 1e-21 GAV65989.1 zf-RanBP domain-containing protein [Cephalotus follic... 95 1e-21 XP_017605087.1 PREDICTED: zinc finger Ran-binding domain-contain... 93 6e-21 XP_011040020.1 PREDICTED: TATA-binding protein-associated factor... 92 8e-21 XP_012073229.1 PREDICTED: TATA-binding protein-associated factor... 92 9e-21 XP_011035663.1 PREDICTED: TATA-binding protein-associated factor... 92 1e-20 XP_002285376.1 PREDICTED: TATA-binding protein-associated factor... 91 2e-20 XP_002282524.1 PREDICTED: TATA-binding protein-associated factor... 91 6e-20 OAY52852.1 hypothetical protein MANES_04G116400 [Manihot esculenta] 90 6e-20 XP_002304153.1 zinc finger family protein [Populus trichocarpa] ... 90 7e-20 >XP_006465374.1 PREDICTED: transcription initiation factor TFIID subunit 15 [Citrus sinensis] Length = 151 Score = 105 bits (261), Expect = 9e-26 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY Sbjct: 107 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 151 >XP_006427203.1 hypothetical protein CICLE_v10026703mg [Citrus clementina] ESR40443.1 hypothetical protein CICLE_v10026703mg [Citrus clementina] KDO52876.1 hypothetical protein CISIN_1g031858mg [Citrus sinensis] Length = 151 Score = 105 bits (261), Expect = 9e-26 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY Sbjct: 107 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 151 >OMP10815.1 Zinc finger, RanBP2-type [Corchorus capsularis] Length = 145 Score = 99.0 bits (245), Expect = 2e-23 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTRSGCNEHNFASRMECFRC+APRDF NR SY Sbjct: 101 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCSAPRDFSNRTSY 145 >OMP00119.1 Zinc finger, RanBP2-type [Corchorus olitorius] Length = 145 Score = 99.0 bits (245), Expect = 2e-23 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTRSGCNEHNFASRMECFRC+APRDF NR SY Sbjct: 101 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCSAPRDFSNRTSY 145 >XP_007023906.1 PREDICTED: TATA-binding protein-associated factor 2N [Theobroma cacao] XP_017978108.1 PREDICTED: TATA-binding protein-associated factor 2N [Theobroma cacao] EOY26527.1 Ran BP2/NZF zinc finger-like superfamily protein isoform 1 [Theobroma cacao] EOY26528.1 Ran BP2/NZF zinc finger-like superfamily protein isoform 1 [Theobroma cacao] Length = 145 Score = 99.0 bits (245), Expect = 2e-23 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTRSGCNEHNFASRMECFRC+APRDF NR SY Sbjct: 101 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCSAPRDFNNRTSY 145 >XP_016725716.1 PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Gossypium hirsutum] Length = 139 Score = 95.1 bits (235), Expect = 5e-22 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTR GCNEHNFASRMECFRC+APR+F NR SY Sbjct: 95 GGNRSGWKSGDWICTRLGCNEHNFASRMECFRCSAPREFNNRTSY 139 >XP_017644852.1 PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Gossypium arboreum] AAZ94630.1 zinc finger protein-like protein [Gossypium hirsutum] KHG12732.1 putative RNA-binding C17H9.04c [Gossypium arboreum] Length = 139 Score = 95.1 bits (235), Expect = 5e-22 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTR GCNEHNFASRMECFRC+APR+F NR SY Sbjct: 95 GGNRSGWKSGDWICTRLGCNEHNFASRMECFRCSAPREFNNRTSY 139 >XP_012452693.1 PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Gossypium raimondii] KJB68110.1 hypothetical protein B456_010G227000 [Gossypium raimondii] KJB68111.1 hypothetical protein B456_010G227000 [Gossypium raimondii] Length = 139 Score = 95.1 bits (235), Expect = 5e-22 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTR GCNEHNFASRMECFRC+APR+F NR SY Sbjct: 95 GGNRSGWKSGDWICTRLGCNEHNFASRMECFRCSAPREFNNRASY 139 >XP_012443263.1 PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Gossypium raimondii] XP_016688967.1 PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Gossypium hirsutum] KJB56654.1 hypothetical protein B456_009G130100 [Gossypium raimondii] Length = 148 Score = 95.1 bits (235), Expect = 7e-22 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTRSGCNEHNFASRMECFRC+APRDF R SY Sbjct: 104 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCSAPRDFTARTSY 148 >XP_010254345.1 PREDICTED: uncharacterized RNA-binding protein C17H9.04c isoform X1 [Nelumbo nucifera] Length = 150 Score = 94.7 bits (234), Expect = 1e-21 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GG RSGW SGDWICTRSGCNEHNFASRMEC+RCNAPRD GN+ SY Sbjct: 106 GGGRSGWKSGDWICTRSGCNEHNFASRMECYRCNAPRDSGNKPSY 150 >XP_002299606.1 zinc finger family protein [Populus trichocarpa] ABK93638.1 unknown [Populus trichocarpa] EEE84411.1 zinc finger family protein [Populus trichocarpa] Length = 151 Score = 94.7 bits (234), Expect = 1e-21 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTR GCNEHNFASRMECF+CNAPRD NR SY Sbjct: 107 GGNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNRTSY 151 >GAV65989.1 zf-RanBP domain-containing protein [Cephalotus follicularis] Length = 154 Score = 94.7 bits (234), Expect = 1e-21 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNR 382 GG RSGW SGDWICTRSGCNEHNFASRMECFRCNAPRDF NR Sbjct: 112 GGGRSGWKSGDWICTRSGCNEHNFASRMECFRCNAPRDFSNR 153 >XP_017605087.1 PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Gossypium arboreum] KHG30418.1 Zinc finger Ran-binding domain-containing 2 [Gossypium arboreum] Length = 148 Score = 92.8 bits (229), Expect = 6e-21 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRS W SGDWICTRSGCNEHNFASRMECFRC+APRDF R SY Sbjct: 104 GGNRSSWKSGDWICTRSGCNEHNFASRMECFRCSAPRDFTARTSY 148 >XP_011040020.1 PREDICTED: TATA-binding protein-associated factor 2N [Populus euphratica] XP_011040022.1 PREDICTED: TATA-binding protein-associated factor 2N [Populus euphratica] Length = 151 Score = 92.4 bits (228), Expect = 8e-21 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTR GCNEHNFASRMECF+CNAPRD N SY Sbjct: 107 GGNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNTTSY 151 >XP_012073229.1 PREDICTED: TATA-binding protein-associated factor 2N isoform X2 [Jatropha curcas] KDP37123.1 hypothetical protein JCGZ_06179 [Jatropha curcas] Length = 155 Score = 92.4 bits (228), Expect = 9e-21 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 G NRSGW SGDWICTR GCNEHNFASRMECF+CNAPRD NR SY Sbjct: 111 GSNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNRTSY 155 >XP_011035663.1 PREDICTED: TATA-binding protein-associated factor 2N-like [Populus euphratica] XP_011014606.1 PREDICTED: TATA-binding protein-associated factor 2N-like [Populus euphratica] Length = 151 Score = 92.0 bits (227), Expect = 1e-20 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 GGNRSGW SGDWICTR GCNEHNFASRMECF+CNAPRD N SY Sbjct: 107 GGNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNGTSY 151 >XP_002285376.1 PREDICTED: TATA-binding protein-associated factor 2N [Vitis vinifera] CBI36269.3 unnamed protein product, partial [Vitis vinifera] Length = 150 Score = 91.3 bits (225), Expect = 2e-20 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 G RSGW SGDWIC+RSGCNEHNFASRMECFRCNAPRD N+ SY Sbjct: 106 GSGRSGWKSGDWICSRSGCNEHNFASRMECFRCNAPRDLSNKTSY 150 >XP_002282524.1 PREDICTED: TATA-binding protein-associated factor 2N [Vitis vinifera] CBI21013.3 unnamed protein product, partial [Vitis vinifera] Length = 158 Score = 90.5 bits (223), Expect = 6e-20 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 G RSGW SGDWIC RSGCNEHNFASRMECFRCNAPRD GN+ SY Sbjct: 112 GIGRSGWKSGDWICNRSGCNEHNFASRMECFRCNAPRDSGNKSSY 156 >OAY52852.1 hypothetical protein MANES_04G116400 [Manihot esculenta] Length = 148 Score = 90.1 bits (222), Expect = 6e-20 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 G NRSGW SGDWICTR GCNEHNFASRMECF+CNAPR+ NR SY Sbjct: 104 GSNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRELSNRPSY 148 >XP_002304153.1 zinc finger family protein [Populus trichocarpa] XP_006385496.1 hypothetical protein POPTR_0003s05990g [Populus trichocarpa] EEE79132.1 zinc finger family protein [Populus trichocarpa] ERP63293.1 hypothetical protein POPTR_0003s05990g [Populus trichocarpa] Length = 151 Score = 90.1 bits (222), Expect = 7e-20 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = -1 Query: 507 GGNRSGWMSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 373 G NRSGW SGDWICTR GCNEHNFASRMECF+CNAPRD N SY Sbjct: 107 GSNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNTTSY 151