BLASTX nr result
ID: Phellodendron21_contig00045485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045485 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006493425.1 PREDICTED: plastid division protein CDP1, chlorop... 124 2e-30 KDO46155.1 hypothetical protein CISIN_1g0034421mg, partial [Citr... 122 9e-30 XP_006441426.1 hypothetical protein CICLE_v10018888mg [Citrus cl... 122 1e-29 XP_010069516.1 PREDICTED: plastid division protein CDP1, chlorop... 103 6e-23 XP_010069515.1 PREDICTED: plastid division protein CDP1, chlorop... 103 6e-23 XP_016732258.1 PREDICTED: plastid division protein CDP1, chlorop... 102 8e-23 XP_012434838.1 PREDICTED: plastid division protein CDP1, chlorop... 102 8e-23 XP_007029350.2 PREDICTED: plastid division protein CDP1, chlorop... 102 1e-22 XP_017630735.1 PREDICTED: plastid division protein CDP1, chlorop... 102 1e-22 XP_016712520.1 PREDICTED: plastid division protein CDP1, chlorop... 102 1e-22 OMO77984.1 hypothetical protein COLO4_24905 [Corchorus olitorius] 101 2e-22 OMO78025.1 hypothetical protein CCACVL1_14700 [Corchorus capsula... 101 2e-22 GAV73608.1 DUF4101 domain-containing protein [Cephalotus follicu... 100 4e-22 EOY09852.1 ARC6-like protein isoform 1 [Theobroma cacao] 100 7e-22 XP_010663916.1 PREDICTED: plastid division protein CDP1, chlorop... 99 1e-21 CBI35272.3 unnamed protein product, partial [Vitis vinifera] 99 1e-21 XP_002269313.2 PREDICTED: plastid division protein CDP1, chlorop... 99 1e-21 XP_011072068.1 PREDICTED: plastid division protein CDP1, chlorop... 99 2e-21 XP_006376689.1 hypothetical protein POPTR_0012s033001g, partial ... 96 1e-20 XP_016203973.1 PREDICTED: plastid division protein CDP1, chlorop... 96 2e-20 >XP_006493425.1 PREDICTED: plastid division protein CDP1, chloroplastic [Citrus sinensis] Length = 819 Score = 124 bits (312), Expect = 2e-30 Identities = 59/78 (75%), Positives = 62/78 (79%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTI+QADI+SDGGVG VDESQPKNPNYYSSYKIRYVLR Sbjct: 742 YWRFVLLQLTIVQADIISDGGVGEIAEIEAVLEEAAELVDESQPKNPNYYSSYKIRYVLR 801 Query: 182 KKDDGSWRFCKADIQTPS 235 KKDDG+WRFCK DIQTPS Sbjct: 802 KKDDGTWRFCKGDIQTPS 819 >KDO46155.1 hypothetical protein CISIN_1g0034421mg, partial [Citrus sinensis] Length = 568 Score = 122 bits (305), Expect = 9e-30 Identities = 58/78 (74%), Positives = 61/78 (78%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTI+QADI+S GGVG VDESQPKNPNYYSSYKIRYVLR Sbjct: 491 YWRFVLLQLTIVQADIISHGGVGEIAEIEAVLEEAAELVDESQPKNPNYYSSYKIRYVLR 550 Query: 182 KKDDGSWRFCKADIQTPS 235 KKDDG+WRFCK DIQTPS Sbjct: 551 KKDDGTWRFCKGDIQTPS 568 >XP_006441426.1 hypothetical protein CICLE_v10018888mg [Citrus clementina] ESR54666.1 hypothetical protein CICLE_v10018888mg [Citrus clementina] Length = 812 Score = 122 bits (305), Expect = 1e-29 Identities = 58/78 (74%), Positives = 61/78 (78%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTI+QADI+S GGVG VDESQPKNPNYYSSYKIRYVLR Sbjct: 735 YWRFVLLQLTIVQADIISHGGVGEIAEIEAVLEEAAELVDESQPKNPNYYSSYKIRYVLR 794 Query: 182 KKDDGSWRFCKADIQTPS 235 KKDDG+WRFCK DIQTPS Sbjct: 795 KKDDGTWRFCKGDIQTPS 812 >XP_010069516.1 PREDICTED: plastid division protein CDP1, chloroplastic isoform X2 [Eucalyptus grandis] KCW57894.1 hypothetical protein EUGRSUZ_H00644 [Eucalyptus grandis] Length = 823 Score = 103 bits (256), Expect = 6e-23 Identities = 48/78 (61%), Positives = 57/78 (73%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQL++L+A+ LSDG VDESQPKNPNYYSSYKIRYVL+ Sbjct: 746 YWRFVLLQLSVLRAETLSDGMGIEMAEIDALLEEAAELVDESQPKNPNYYSSYKIRYVLK 805 Query: 182 KKDDGSWRFCKADIQTPS 235 K++DGSW+FCK D+Q PS Sbjct: 806 KQEDGSWKFCKGDVQAPS 823 >XP_010069515.1 PREDICTED: plastid division protein CDP1, chloroplastic isoform X1 [Eucalyptus grandis] Length = 824 Score = 103 bits (256), Expect = 6e-23 Identities = 48/78 (61%), Positives = 57/78 (73%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQL++L+A+ LSDG VDESQPKNPNYYSSYKIRYVL+ Sbjct: 747 YWRFVLLQLSVLRAETLSDGMGIEMAEIDALLEEAAELVDESQPKNPNYYSSYKIRYVLK 806 Query: 182 KKDDGSWRFCKADIQTPS 235 K++DGSW+FCK D+Q PS Sbjct: 807 KQEDGSWKFCKGDVQAPS 824 >XP_016732258.1 PREDICTED: plastid division protein CDP1, chloroplastic-like [Gossypium hirsutum] Length = 742 Score = 102 bits (255), Expect = 8e-23 Identities = 49/78 (62%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTIL+ADIL D G VDESQPKNPNYYS+YKIRY+LR Sbjct: 665 YWRFVLLQLTILRADILLDIHRGEIAEIEALLEEAAELVDESQPKNPNYYSTYKIRYILR 724 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+ PS Sbjct: 725 RQDDGSWKFCGGDIEMPS 742 >XP_012434838.1 PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium raimondii] XP_012434839.1 PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium raimondii] KJB46137.1 hypothetical protein B456_007G350000 [Gossypium raimondii] KJB46138.1 hypothetical protein B456_007G350000 [Gossypium raimondii] KJB46139.1 hypothetical protein B456_007G350000 [Gossypium raimondii] Length = 829 Score = 102 bits (255), Expect = 8e-23 Identities = 49/78 (62%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTIL+ADIL D G VDESQPKNPNYYS+YKIRY+LR Sbjct: 752 YWRFVLLQLTILRADILLDIHRGEIAEIEALLEEAAELVDESQPKNPNYYSTYKIRYILR 811 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+ PS Sbjct: 812 RQDDGSWKFCGGDIEMPS 829 >XP_007029350.2 PREDICTED: plastid division protein CDP1, chloroplastic [Theobroma cacao] Length = 829 Score = 102 bits (254), Expect = 1e-22 Identities = 47/78 (60%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTIL+ADIL D VDES+PKNPNYYS+YKIRY+L+ Sbjct: 752 YWRFVLLQLTILRADILLDRNAREMAEIEALLEEAAELVDESEPKNPNYYSTYKIRYILK 811 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+TPS Sbjct: 812 RQDDGSWKFCGGDIETPS 829 >XP_017630735.1 PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium arboreum] XP_017630736.1 PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium arboreum] Length = 829 Score = 102 bits (254), Expect = 1e-22 Identities = 48/78 (61%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTIL+AD+L D G VDESQPKNPNYYS+YKIRY+LR Sbjct: 752 YWRFVLLQLTILRADVLLDIHRGEIAEIEALLEEAAELVDESQPKNPNYYSTYKIRYILR 811 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+ PS Sbjct: 812 RQDDGSWKFCGGDIEMPS 829 >XP_016712520.1 PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium hirsutum] XP_016712527.1 PREDICTED: plastid division protein CDP1, chloroplastic [Gossypium hirsutum] Length = 829 Score = 102 bits (254), Expect = 1e-22 Identities = 48/78 (61%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTIL+AD+L D G VDESQPKNPNYYS+YKIRY+LR Sbjct: 752 YWRFVLLQLTILRADVLLDIHRGEIAEIEALLEEAAELVDESQPKNPNYYSTYKIRYILR 811 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+ PS Sbjct: 812 RQDDGSWKFCGGDIEMPS 829 >OMO77984.1 hypothetical protein COLO4_24905 [Corchorus olitorius] Length = 732 Score = 101 bits (252), Expect = 2e-22 Identities = 46/78 (58%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YW+FVLL+LTIL+ADIL D G VDESQPKNPNYYS+YKIRY+L+ Sbjct: 655 YWKFVLLRLTILRADILLDRNTGETAEIEALLEEAAELVDESQPKNPNYYSTYKIRYILK 714 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+ PS Sbjct: 715 RQDDGSWKFCGGDIEMPS 732 >OMO78025.1 hypothetical protein CCACVL1_14700 [Corchorus capsularis] Length = 819 Score = 101 bits (252), Expect = 2e-22 Identities = 46/78 (58%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YW+FVLL+LTIL+ADIL D G VDESQPKNPNYYS+YKIRY+L+ Sbjct: 742 YWKFVLLRLTILRADILLDRNTGEMAEIEALLEEAAELVDESQPKNPNYYSTYKIRYILK 801 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSW+FC DI+ PS Sbjct: 802 RQDDGSWKFCGGDIEMPS 819 >GAV73608.1 DUF4101 domain-containing protein [Cephalotus follicularis] Length = 823 Score = 100 bits (250), Expect = 4e-22 Identities = 48/78 (61%), Positives = 56/78 (71%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 +WRFVLLQL++LQA I SDG G VDESQ KNPNYYS+YK+RYVLR Sbjct: 746 FWRFVLLQLSVLQAYIFSDGIGGEMAEIEARLEEAAELVDESQLKNPNYYSTYKVRYVLR 805 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSWRFC+ DIQ PS Sbjct: 806 RQDDGSWRFCEGDIQMPS 823 >EOY09852.1 ARC6-like protein isoform 1 [Theobroma cacao] Length = 829 Score = 100 bits (248), Expect = 7e-22 Identities = 46/78 (58%), Positives = 55/78 (70%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQLTIL+ADIL D VDES+PKNPNYYS+YKIRY+L+ Sbjct: 752 YWRFVLLQLTILRADILLDRNAREMAEIEALLEEAAELVDESEPKNPNYYSTYKIRYILK 811 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDG W+FC DI+TPS Sbjct: 812 RQDDGLWKFCGGDIETPS 829 >XP_010663916.1 PREDICTED: plastid division protein CDP1, chloroplastic isoform X2 [Vitis vinifera] Length = 706 Score = 99.4 bits (246), Expect = 1e-21 Identities = 45/77 (58%), Positives = 56/77 (72%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 +WRFVLLQL++++ADILSD VDESQPKNPNYYS+YK+RY+LR Sbjct: 629 FWRFVLLQLSVIRADILSDSTGIEMAEIEALLEEAAELVDESQPKNPNYYSTYKVRYLLR 688 Query: 182 KKDDGSWRFCKADIQTP 232 ++DDGSWRFC+ DIQ P Sbjct: 689 RQDDGSWRFCEGDIQIP 705 >CBI35272.3 unnamed protein product, partial [Vitis vinifera] Length = 822 Score = 99.4 bits (246), Expect = 1e-21 Identities = 45/77 (58%), Positives = 56/77 (72%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 +WRFVLLQL++++ADILSD VDESQPKNPNYYS+YK+RY+LR Sbjct: 745 FWRFVLLQLSVIRADILSDSTGIEMAEIEALLEEAAELVDESQPKNPNYYSTYKVRYLLR 804 Query: 182 KKDDGSWRFCKADIQTP 232 ++DDGSWRFC+ DIQ P Sbjct: 805 RQDDGSWRFCEGDIQIP 821 >XP_002269313.2 PREDICTED: plastid division protein CDP1, chloroplastic isoform X1 [Vitis vinifera] Length = 824 Score = 99.4 bits (246), Expect = 1e-21 Identities = 45/77 (58%), Positives = 56/77 (72%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 +WRFVLLQL++++ADILSD VDESQPKNPNYYS+YK+RY+LR Sbjct: 747 FWRFVLLQLSVIRADILSDSTGIEMAEIEALLEEAAELVDESQPKNPNYYSTYKVRYLLR 806 Query: 182 KKDDGSWRFCKADIQTP 232 ++DDGSWRFC+ DIQ P Sbjct: 807 RQDDGSWRFCEGDIQIP 823 >XP_011072068.1 PREDICTED: plastid division protein CDP1, chloroplastic [Sesamum indicum] Length = 831 Score = 99.0 bits (245), Expect = 2e-21 Identities = 45/78 (57%), Positives = 55/78 (70%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 +WRFVLLQLT++ ADIL DG VDE+QPKNP YYS YKIRY+L+ Sbjct: 754 FWRFVLLQLTVVHADILKDGTGREMAEIEVLLEEAAELVDETQPKNPTYYSPYKIRYLLK 813 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSWRFC+ DI+TPS Sbjct: 814 RQDDGSWRFCEGDIRTPS 831 >XP_006376689.1 hypothetical protein POPTR_0012s033001g, partial [Populus trichocarpa] ERP54486.1 hypothetical protein POPTR_0012s033001g, partial [Populus trichocarpa] Length = 485 Score = 96.3 bits (238), Expect = 1e-20 Identities = 47/78 (60%), Positives = 55/78 (70%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLLQL+IL+ADI SDG VDESQ KNPNYYS+YK YVL+ Sbjct: 408 YWRFVLLQLSILRADIFSDGYGLEIAEIEVLLEEAAELVDESQQKNPNYYSTYKTLYVLK 467 Query: 182 KKDDGSWRFCKADIQTPS 235 ++DDGSWRFC++DIQT S Sbjct: 468 RQDDGSWRFCESDIQTSS 485 >XP_016203973.1 PREDICTED: plastid division protein CDP1, chloroplastic [Arachis ipaensis] Length = 813 Score = 95.9 bits (237), Expect = 2e-20 Identities = 41/77 (53%), Positives = 57/77 (74%) Frame = +2 Query: 2 YWRFVLLQLTILQADILSDGGVGXXXXXXXXXXXXXXXVDESQPKNPNYYSSYKIRYVLR 181 YWRFVLL+L++L+ADILSDG VD+SQ KNPNYYS+YK++Y+L+ Sbjct: 737 YWRFVLLKLSVLRADILSDGSGVDMAEIEALLEEAAELVDDSQQKNPNYYSTYKVKYILK 796 Query: 182 KKDDGSWRFCKADIQTP 232 +++DGSW+FC+ DI+TP Sbjct: 797 RQEDGSWKFCEGDIRTP 813