BLASTX nr result
ID: Phellodendron21_contig00045419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045419 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMS98148.1 hypothetical protein BVRB_4g095340 isoform B [Beta vu... 58 3e-07 BAS97971.1 Os06g0509100, partial [Oryza sativa Japonica Group] 52 2e-06 XP_002314806.1 hypothetical protein POPTR_0010s12240g [Populus t... 55 3e-06 >KMS98148.1 hypothetical protein BVRB_4g095340 isoform B [Beta vulgaris subsp. vulgaris] Length = 611 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +3 Query: 267 MCKCFVSSLPLFCLQYTSTIDIWSIGCIFTELLTGKPLF 383 +C F S L LQYT IDIWSIGCIF E+LTGKPLF Sbjct: 200 LCGSFFSKLVFLVLQYTPAIDIWSIGCIFAEVLTGKPLF 238 >BAS97971.1 Os06g0509100, partial [Oryza sativa Japonica Group] Length = 65 Score = 52.0 bits (123), Expect = 2e-06 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +3 Query: 297 LFC---LQYTSTIDIWSIGCIFTELLTGKPLF 383 +FC LQ+T IDIWSIGCIF ELLTGKPLF Sbjct: 2 IFCHWLLQFTPAIDIWSIGCIFAELLTGKPLF 33 >XP_002314806.1 hypothetical protein POPTR_0010s12240g [Populus trichocarpa] EEF00977.1 hypothetical protein POPTR_0010s12240g [Populus trichocarpa] Length = 500 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +3 Query: 276 CFVSSLPLFCLQYTSTIDIWSIGCIFTELLTGKPLF 383 C L + LQYT IDIWSIGCIF ELLTGKPLF Sbjct: 196 CLTFFLKICVLQYTPAIDIWSIGCIFAELLTGKPLF 231