BLASTX nr result
ID: Phellodendron21_contig00045342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045342 (575 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006486954.1 PREDICTED: classical arabinogalactan protein 9 [C... 71 3e-12 >XP_006486954.1 PREDICTED: classical arabinogalactan protein 9 [Citrus sinensis] Length = 151 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 428 LNTLAPGPAQATTDDSGVEKLWSMERMVGSMVLGWAALCLLI 303 LN ++PGPAQ TTD SGVEKLWSME++VGS V GWA LCLL+ Sbjct: 110 LNAVSPGPAQTTTDASGVEKLWSMEKVVGSAVFGWAVLCLLL 151