BLASTX nr result
ID: Phellodendron21_contig00045339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045339 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013422390.1 glycoside hydrolase, partial [Aureobasidium namib... 85 3e-17 >XP_013422390.1 glycoside hydrolase, partial [Aureobasidium namibiae CBS 147.97] KEQ68212.1 glycoside hydrolase, partial [Aureobasidium namibiae CBS 147.97] Length = 277 Score = 85.1 bits (209), Expect = 3e-17 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = +2 Query: 14 NFGDALTPEQNVVMDLHWWNNFGVALTLEQLKDSYCSLPPASTPHAWKNPVLIGEFS 184 ++GD P Q V++DLHWWN F +L L+D+YCSLPPAS+PHAW NP++IGEFS Sbjct: 221 SWGDVFNPSQKVILDLHWWNLFTDIPSLTVLEDTYCSLPPASSPHAWNNPIIIGEFS 277