BLASTX nr result
ID: Phellodendron21_contig00045316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045316 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013898896.1 ribulose-phosphate 3-epimerase [Monoraphidium neg... 88 3e-19 XP_001699872.1 ribulose phosphate-3-epimerase [Chlamydomonas rei... 87 5e-19 XP_002955598.1 hypothetical protein VOLCADRAFT_109319 [Volvox ca... 86 2e-18 KDD76591.1 ribulose-phosphate 3 epimerase [Helicosporidium sp. A... 85 3e-18 XP_005851858.1 hypothetical protein CHLNCDRAFT_48415 [Chlorella ... 83 3e-17 JAT74518.1 hypothetical protein g.31774 [Auxenochlorella prototh... 74 6e-14 XP_011396034.1 Ribulose-phosphate 3-epimerase, cytoplasmic isofo... 74 6e-14 CEF98317.1 Ribulose-phosphate binding barrel [Ostreococcus tauri] 73 1e-13 XP_001418433.1 predicted protein [Ostreococcus lucimarinus CCE99... 72 3e-13 XP_009161603.1 ribulose-phosphate 3-epimerase [Exophiala dermati... 72 4e-13 XP_007917448.1 putative ribulose-phosphate 3-epimerase protein [... 72 5e-13 WP_022716102.1 ribulose-phosphate 3-epimerase [Rhizobium mongole... 71 5e-13 XP_003079806.1 ribulose-phosphate 3-epimerase (IC) [Ostreococcus... 73 5e-13 SCW79301.1 ribulose-5-phosphate 3-epimerase [Rhizobium loessense] 71 7e-13 XP_002501826.1 ribulose-phosphate 3-epimerase [Micromonas commod... 70 9e-13 XP_016639807.1 hypothetical protein SAPIO_CDS8992 [Scedosporium ... 71 9e-13 WP_074072223.1 ribulose-phosphate 3-epimerase [Rhizobium gallicu... 70 1e-12 WP_024586937.1 ribulose-phosphate 3-epimerase [Aliihoeflea sp. 2WW] 70 1e-12 ODQ63687.1 Ribulose-phosphate 3-epimerase [Nadsonia fulvescens v... 70 1e-12 WP_040115759.1 ribulose-phosphate 3-epimerase [Rhizobium gallicu... 70 1e-12 >XP_013898896.1 ribulose-phosphate 3-epimerase [Monoraphidium neglectum] KIY99876.1 ribulose-phosphate 3-epimerase [Monoraphidium neglectum] Length = 268 Score = 88.2 bits (217), Expect = 3e-19 Identities = 41/68 (60%), Positives = 49/68 (72%) Frame = +2 Query: 80 SVRLNDSQRALMGIPLPTKTAGRDRPDTIISPSILSADFAKLADESQKVIKLGADWLHVD 259 S+ N + PL AGRDRP +ISPSILSADFA LADE ++++ LGADWLH+D Sbjct: 7 SLAANGNGACAAAAPLDALPAGRDRPAALISPSILSADFATLADECKRIVDLGADWLHID 66 Query: 260 VMDGHFVP 283 VMDGHFVP Sbjct: 67 VMDGHFVP 74 >XP_001699872.1 ribulose phosphate-3-epimerase [Chlamydomonas reinhardtii] EDP07568.1 ribulose phosphate-3-epimerase, partial [Chlamydomonas reinhardtii] Length = 254 Score = 87.4 bits (215), Expect = 5e-19 Identities = 36/55 (65%), Positives = 49/55 (89%) Frame = +2 Query: 119 IPLPTKTAGRDRPDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 +P+P ++AG+DRP ++PSILSADFA+LA+E ++++ LGADWLHVDVMDGHFVP Sbjct: 4 VPMPKRSAGQDRPAATVAPSILSADFARLAEECKRMVDLGADWLHVDVMDGHFVP 58 >XP_002955598.1 hypothetical protein VOLCADRAFT_109319 [Volvox carteri f. nagariensis] EFJ43238.1 hypothetical protein VOLCADRAFT_109319 [Volvox carteri f. nagariensis] Length = 258 Score = 86.3 bits (212), Expect = 2e-18 Identities = 38/55 (69%), Positives = 47/55 (85%) Frame = +2 Query: 119 IPLPTKTAGRDRPDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 I LP ++ G DRP II+PSILS+DFA+LADE ++++ LGADWLHVDVMDGHFVP Sbjct: 4 ISLPKRSEGHDRPPAIIAPSILSSDFARLADECKRMVDLGADWLHVDVMDGHFVP 58 >KDD76591.1 ribulose-phosphate 3 epimerase [Helicosporidium sp. ATCC 50920] Length = 237 Score = 85.1 bits (209), Expect = 3e-18 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +2 Query: 122 PLPTKTAGRDRPDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 PL + +GRDRP TIISPS+LS DFA+LA+E ++K GADWLHVDVMDGHFVP Sbjct: 3 PLAGRPSGRDRPPTIISPSLLSCDFARLAEECAAIVKEGADWLHVDVMDGHFVP 56 >XP_005851858.1 hypothetical protein CHLNCDRAFT_48415 [Chlorella variabilis] EFN59756.1 hypothetical protein CHLNCDRAFT_48415 [Chlorella variabilis] Length = 246 Score = 82.8 bits (203), Expect = 3e-17 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = +2 Query: 143 GRDRPDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 GRDRP TII+PS+LS DF +LA+ES+++++LGADWLHVDVMDGHFVP Sbjct: 3 GRDRPPTIIAPSLLSCDFGRLAEESKRMVELGADWLHVDVMDGHFVP 49 >JAT74518.1 hypothetical protein g.31774 [Auxenochlorella protothecoides] Length = 241 Score = 73.9 bits (180), Expect = 6e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P IISPSILS+DFA LA ES+K++ +GADWLHVDVMDGHFVP Sbjct: 14 PPAIISPSILSSDFADLAAESKKILSMGADWLHVDVMDGHFVP 56 >XP_011396034.1 Ribulose-phosphate 3-epimerase, cytoplasmic isoform [Auxenochlorella protothecoides] KFM23164.1 Ribulose-phosphate 3-epimerase, cytoplasmic isoform [Auxenochlorella protothecoides] Length = 241 Score = 73.9 bits (180), Expect = 6e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P IISPSILS+DFA LA ES+K++ +GADWLHVDVMDGHFVP Sbjct: 14 PPAIISPSILSSDFADLAAESKKILSMGADWLHVDVMDGHFVP 56 >CEF98317.1 Ribulose-phosphate binding barrel [Ostreococcus tauri] Length = 227 Score = 72.8 bits (177), Expect = 1e-13 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 152 RPDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 R +ISPS+LS DFA++ADES+KVI GADWLH+DVMDGHFVP Sbjct: 4 RNQPVISPSLLSCDFARMADESKKVIACGADWLHLDVMDGHFVP 47 >XP_001418433.1 predicted protein [Ostreococcus lucimarinus CCE9901] ABO96726.1 predicted protein [Ostreococcus lucimarinus CCE9901] Length = 231 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +2 Query: 164 IISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 +ISPS+LS DFA++ADES+KVI GADWLH+DVMDGHFVP Sbjct: 10 VISPSLLSCDFARMADESRKVIACGADWLHLDVMDGHFVP 49 >XP_009161603.1 ribulose-phosphate 3-epimerase [Exophiala dermatitidis NIH/UT8656] EHY61142.1 ribulose-phosphate 3-epimerase [Exophiala dermatitidis NIH/UT8656] Length = 254 Score = 72.0 bits (175), Expect = 4e-13 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P II+PSILSADFAKL +E K +K GADWLHVD+MDGHFVP Sbjct: 3 PPAIIAPSILSADFAKLGEECAKTMKQGADWLHVDIMDGHFVP 45 >XP_007917448.1 putative ribulose-phosphate 3-epimerase protein [Phaeoacremonium minimum UCRPA7] EON97766.1 putative ribulose-phosphate 3-epimerase protein [Phaeoacremonium minimum UCRPA7] Length = 251 Score = 71.6 bits (174), Expect = 5e-13 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P+ II+PSILSADFAKL +E K I GADWLHVD+MDGHFVP Sbjct: 3 PNAIIAPSILSADFAKLGEECAKTIAQGADWLHVDIMDGHFVP 45 >WP_022716102.1 ribulose-phosphate 3-epimerase [Rhizobium mongolense] Length = 229 Score = 71.2 bits (173), Expect = 5e-13 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +2 Query: 161 TIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 TII+PSILSADF++L DE ++V+K GADW+H+DVMDGHFVP Sbjct: 5 TIIAPSILSADFSRLGDEVEEVVKAGADWIHLDVMDGHFVP 45 >XP_003079806.1 ribulose-phosphate 3-epimerase (IC) [Ostreococcus tauri] Length = 460 Score = 72.8 bits (177), Expect = 5e-13 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 152 RPDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 R +ISPS+LS DFA++ADES+KVI GADWLH+DVMDGHFVP Sbjct: 237 RNQPVISPSLLSCDFARMADESKKVIACGADWLHLDVMDGHFVP 280 >SCW79301.1 ribulose-5-phosphate 3-epimerase [Rhizobium loessense] Length = 229 Score = 70.9 bits (172), Expect = 7e-13 Identities = 29/41 (70%), Positives = 38/41 (92%) Frame = +2 Query: 161 TIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 TII+PSILSADF++L DE ++V+K GADW+H+D+MDGHFVP Sbjct: 5 TIIAPSILSADFSRLGDEVEEVVKAGADWIHLDIMDGHFVP 45 >XP_002501826.1 ribulose-phosphate 3-epimerase [Micromonas commoda] ACO63084.1 ribulose-phosphate 3-epimerase [Micromonas commoda] Length = 222 Score = 70.5 bits (171), Expect = 9e-13 Identities = 29/43 (67%), Positives = 39/43 (90%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P I+SPS+L++DFA++ADE++KVI GADWLH+D+MDGHFVP Sbjct: 3 PAAIVSPSLLASDFARMADEAKKVIDGGADWLHLDIMDGHFVP 45 >XP_016639807.1 hypothetical protein SAPIO_CDS8992 [Scedosporium apiospermum] KEZ40008.1 hypothetical protein SAPIO_CDS8992 [Scedosporium apiospermum] Length = 248 Score = 70.9 bits (172), Expect = 9e-13 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P II+PSILSADFAKL +E + I+ GADWLHVD+MDGHFVP Sbjct: 3 PPAIIAPSILSADFAKLGEECSRTIEQGADWLHVDIMDGHFVP 45 >WP_074072223.1 ribulose-phosphate 3-epimerase [Rhizobium gallicum] APO71984.1 D-ribulose-5 phosphate 3-epimerase (plasmid) [Rhizobium gallicum] Length = 229 Score = 70.5 bits (171), Expect = 1e-12 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +2 Query: 161 TIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 +II+PSILSADF++L DE ++V+K GADWLH+DVMDGHFVP Sbjct: 5 SIIAPSILSADFSRLGDEVEEVVKAGADWLHLDVMDGHFVP 45 >WP_024586937.1 ribulose-phosphate 3-epimerase [Aliihoeflea sp. 2WW] Length = 229 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +2 Query: 161 TIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 T+I+PS+LSADF+KL DE + V+K GADW+H+DVMDGHFVP Sbjct: 6 TLIAPSVLSADFSKLGDEVEAVVKAGADWIHLDVMDGHFVP 46 >ODQ63687.1 Ribulose-phosphate 3-epimerase [Nadsonia fulvescens var. elongata DSM 6958] Length = 225 Score = 70.1 bits (170), Expect = 1e-12 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 155 PDTIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 P ISPSILS DFA LA++ Q+++ LGADWLHVD+MDGHFVP Sbjct: 2 PGAYISPSILSGDFADLANDCQRILDLGADWLHVDIMDGHFVP 44 >WP_040115759.1 ribulose-phosphate 3-epimerase [Rhizobium gallicum] AJD45577.1 D-ribulose-5 phosphate 3-epimerase (plasmid) [Rhizobium gallicum bv. gallicum R602] Length = 229 Score = 70.1 bits (170), Expect = 1e-12 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +2 Query: 161 TIISPSILSADFAKLADESQKVIKLGADWLHVDVMDGHFVP 283 +II+PSILSADF++L DE ++VIK GADW+H+DVMDGHFVP Sbjct: 5 SIIAPSILSADFSRLGDEVEEVIKAGADWIHLDVMDGHFVP 45