BLASTX nr result
ID: Phellodendron21_contig00045226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045226 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KEQ61459.1 hypothetical protein M437DRAFT_51766 [Aureobasidium m... 56 5e-07 KEQ87303.1 hypothetical protein M438DRAFT_166523 [Aureobasidium ... 52 8e-06 >KEQ61459.1 hypothetical protein M437DRAFT_51766 [Aureobasidium melanogenum CBS 110374] Length = 834 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +1 Query: 46 VRLYLGPFADAPVVGQIVAAAGGNPDDIVLKNMRDILEKEPRARDDMAFLA 198 V LGP A PVV QI++AAG N ++ VL NMRDIL +P ARDD+ + Sbjct: 771 VHSILGPLAHTPVVAQILSAAGNNVEEHVLLNMRDILANDPAARDDLGIFS 821 >KEQ87303.1 hypothetical protein M438DRAFT_166523 [Aureobasidium pullulans EXF-150] Length = 840 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = +1 Query: 58 LGPFADAPVVGQIVAAAGGNPDDIVLKNMRDILEKEPRARDDMAFLAGILRG 213 LG A PVV QI++AAG N ++ VL NMRDIL +P AR+D+ + L G Sbjct: 780 LGALAHTPVVAQILSAAGNNVEEHVLLNMRDILASDPAAREDLTIFSQRLAG 831