BLASTX nr result
ID: Phellodendron21_contig00045182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045182 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAM84349.1 hypothetical protein ANO11243_023430 [fungal sp. No.1... 55 7e-06 >GAM84349.1 hypothetical protein ANO11243_023430 [fungal sp. No.11243] Length = 569 Score = 54.7 bits (130), Expect = 7e-06 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = +2 Query: 2 RQHPEPLNMADTEDEAKTFSNEYFHAGLGEFHTKGW 109 RQHPEP ++ A F+N+YFHAGLGE+H+KGW Sbjct: 534 RQHPEPQPHMSAKENADKFNNDYFHAGLGEYHSKGW 569