BLASTX nr result
ID: Phellodendron21_contig00045117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045117 (584 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KXL48464.1 hypothetical protein FE78DRAFT_111773, partial [Acido... 56 2e-07 GAM85684.1 hypothetical protein ANO11243_036920 [fungal sp. No.1... 58 1e-06 XP_007676890.1 hypothetical protein BAUCODRAFT_43729, partial [B... 53 3e-06 XP_013426299.1 hypothetical protein M436DRAFT_49955 [Aureobasidi... 52 9e-06 >KXL48464.1 hypothetical protein FE78DRAFT_111773, partial [Acidomyces richmondensis] KYG41278.1 hypothetical protein M433DRAFT_33498, partial [Acidomyces richmondensis BFW] Length = 58 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 501 MGFLDTIRSKYELYRLEQRYTRREKRTT 584 MG LDT+R+KYELYRLEQRYTRREKRTT Sbjct: 1 MGLLDTLRAKYELYRLEQRYTRREKRTT 28 >GAM85684.1 hypothetical protein ANO11243_036920 [fungal sp. No.11243] Length = 340 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 465 NPARKNKKQKPTMGFLDTIRSKYELYRLEQRYTRREKRTT 584 +P+ + + + MG +DT+RSKYELYRLEQRYTRREKRTT Sbjct: 220 SPSPQKHQIQTKMGLIDTLRSKYELYRLEQRYTRREKRTT 259 >XP_007676890.1 hypothetical protein BAUCODRAFT_43729, partial [Baudoinia panamericana UAMH 10762] EMC95577.1 hypothetical protein BAUCODRAFT_43729, partial [Baudoinia panamericana UAMH 10762] Length = 58 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +3 Query: 501 MGFLDTIRSKYELYRLEQRYTRREKRTT 584 MG L+++R+KYELYRLEQRYTRREKRTT Sbjct: 1 MGLLESLRAKYELYRLEQRYTRREKRTT 28 >XP_013426299.1 hypothetical protein M436DRAFT_49955 [Aureobasidium namibiae CBS 147.97] KEQ71985.1 hypothetical protein M436DRAFT_49955 [Aureobasidium namibiae CBS 147.97] Length = 83 Score = 52.0 bits (123), Expect = 9e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 501 MGFLDTIRSKYELYRLEQRYTRREKRTT 584 MGF+DTIR+K ELYRLEQRY RR+KRTT Sbjct: 1 MGFMDTIRAKVELYRLEQRYARRDKRTT 28