BLASTX nr result
ID: Phellodendron21_contig00045058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045058 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006371716.1 hypothetical protein POPTR_0018s00730g [Populus t... 70 5e-13 KJB54827.1 hypothetical protein B456_009G050800 [Gossypium raimo... 70 6e-13 KDO79728.1 hypothetical protein CISIN_1g0279982mg, partial [Citr... 70 7e-13 ACN33512.1 unknown [Zea mays] AQK94028.1 hypothetical protein ZE... 69 7e-13 KDO79727.1 hypothetical protein CISIN_1g0279982mg [Citrus sinensis] 70 7e-13 XP_002324816.2 hypothetical protein POPTR_0018s00730g [Populus t... 70 9e-13 EPS65986.1 hypothetical protein M569_08789 [Genlisea aurea] 70 1e-12 KJB54828.1 hypothetical protein B456_009G050800 [Gossypium raimo... 70 1e-12 KJB54825.1 hypothetical protein B456_009G050800 [Gossypium raimo... 70 2e-12 XP_020097461.1 coiled-coil domain-containing protein 25 [Ananas ... 70 2e-12 GAV91101.1 DUF814 domain-containing protein [Cephalotus follicul... 70 2e-12 OAY78362.1 Coiled-coil domain-containing protein 25 [Ananas como... 70 2e-12 XP_016689603.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 XP_016537973.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 XP_016181162.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 XP_015945725.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 XP_010109459.1 hypothetical protein L484_001798 [Morus notabilis... 70 2e-12 XP_012447084.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 XP_011026583.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 XP_010519905.1 PREDICTED: coiled-coil domain-containing protein ... 70 2e-12 >XP_006371716.1 hypothetical protein POPTR_0018s00730g [Populus trichocarpa] ERP49513.1 hypothetical protein POPTR_0018s00730g [Populus trichocarpa] Length = 153 Score = 69.7 bits (169), Expect = 5e-13 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >KJB54827.1 hypothetical protein B456_009G050800 [Gossypium raimondii] Length = 157 Score = 69.7 bits (169), Expect = 6e-13 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >KDO79728.1 hypothetical protein CISIN_1g0279982mg, partial [Citrus sinensis] Length = 165 Score = 69.7 bits (169), Expect = 7e-13 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >ACN33512.1 unknown [Zea mays] AQK94028.1 hypothetical protein ZEAMMB73_Zm00001d010425 [Zea mays] AQK94029.1 hypothetical protein ZEAMMB73_Zm00001d010425 [Zea mays] AQK94031.1 hypothetical protein ZEAMMB73_Zm00001d010425 [Zea mays] Length = 119 Score = 68.6 bits (166), Expect = 7e-13 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENE+LIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEDLIKYGFPEDIW 38 >KDO79727.1 hypothetical protein CISIN_1g0279982mg [Citrus sinensis] Length = 168 Score = 69.7 bits (169), Expect = 7e-13 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_002324816.2 hypothetical protein POPTR_0018s00730g [Populus trichocarpa] EEF03381.2 hypothetical protein POPTR_0018s00730g [Populus trichocarpa] Length = 177 Score = 69.7 bits (169), Expect = 9e-13 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >EPS65986.1 hypothetical protein M569_08789 [Genlisea aurea] Length = 199 Score = 69.7 bits (169), Expect = 1e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >KJB54828.1 hypothetical protein B456_009G050800 [Gossypium raimondii] Length = 207 Score = 69.7 bits (169), Expect = 1e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >KJB54825.1 hypothetical protein B456_009G050800 [Gossypium raimondii] Length = 211 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_020097461.1 coiled-coil domain-containing protein 25 [Ananas comosus] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >GAV91101.1 DUF814 domain-containing protein [Cephalotus follicularis] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >OAY78362.1 Coiled-coil domain-containing protein 25 [Ananas comosus] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_016689603.1 PREDICTED: coiled-coil domain-containing protein 25-like [Gossypium hirsutum] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_016537973.1 PREDICTED: coiled-coil domain-containing protein 25 [Capsicum annuum] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_016181162.1 PREDICTED: coiled-coil domain-containing protein 25 [Arachis ipaensis] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_015945725.1 PREDICTED: coiled-coil domain-containing protein 25 [Arachis duranensis] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_010109459.1 hypothetical protein L484_001798 [Morus notabilis] EXC22695.1 hypothetical protein L484_001798 [Morus notabilis] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_012447084.1 PREDICTED: coiled-coil domain-containing protein 25-like [Gossypium raimondii] KJB54823.1 hypothetical protein B456_009G050800 [Gossypium raimondii] KJB54824.1 hypothetical protein B456_009G050800 [Gossypium raimondii] KJB54826.1 hypothetical protein B456_009G050800 [Gossypium raimondii] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_011026583.1 PREDICTED: coiled-coil domain-containing protein 25-like [Populus euphratica] XP_011026584.1 PREDICTED: coiled-coil domain-containing protein 25-like [Populus euphratica] XP_011026585.1 PREDICTED: coiled-coil domain-containing protein 25-like [Populus euphratica] XP_011026586.1 PREDICTED: coiled-coil domain-containing protein 25-like [Populus euphratica] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38 >XP_010519905.1 PREDICTED: coiled-coil domain-containing protein 25 [Tarenaya hassleriana] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 290 FYFKARPKATDYTIFMDLKKYENEELIKYDFPEDIW 183 FYFKARP+A DYTIFM L KYENEELIKY FPEDIW Sbjct: 3 FYFKARPEAGDYTIFMGLDKYENEELIKYGFPEDIW 38