BLASTX nr result
ID: Phellodendron21_contig00045044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045044 (500 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007780294.1 hypothetical protein W97_04212 [Coniosporium apol... 55 4e-07 >XP_007780294.1 hypothetical protein W97_04212 [Coniosporium apollinis CBS 100218] EON64977.1 hypothetical protein W97_04212 [Coniosporium apollinis CBS 100218] Length = 70 Score = 54.7 bits (130), Expect = 4e-07 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +2 Query: 188 NLQAHKRDPQNTAFQQRRASLEDQGQKPGVLATTFNNVFKGPSQSK 325 NL A KRDP N QRR+S DQ QKPGVL +NN +GPS SK Sbjct: 25 NLHAFKRDPANDNAAQRRSSFADQAQKPGVLGQMWNNWTRGPSSSK 70