BLASTX nr result
ID: Phellodendron21_contig00045021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045021 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006429004.1 hypothetical protein CICLE_v10011767mg [Citrus cl... 51 3e-06 >XP_006429004.1 hypothetical protein CICLE_v10011767mg [Citrus clementina] ESR42244.1 hypothetical protein CICLE_v10011767mg [Citrus clementina] Length = 409 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -2 Query: 124 WP---TSRESMRAVWKHPHLLVIYSYSAYSDCL*KSYAVTYC 8 WP TSR+SMRAVWK L VIY YSA +CL K YA+T+C Sbjct: 361 WPDGATSRDSMRAVWKLLRLPVIYLYSASPNCLCKFYAITHC 402 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 164 RAEKYFRRVARLD 126 RAEKYFRR ARLD Sbjct: 348 RAEKYFRRGARLD 360