BLASTX nr result
ID: Phellodendron21_contig00045019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00045019 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42163.1 hypothetical protein CISIN_1g048170mg, partial [Citru... 53 3e-06 >KDO42163.1 hypothetical protein CISIN_1g048170mg, partial [Citrus sinensis] Length = 142 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 345 LFCSLLGKPTKETWPGVTYISELLHSYPQ*EPA 247 L L G PTKETWPG YISELLHS PQ EPA Sbjct: 51 LIVRLFGNPTKETWPGANYISELLHSLPQCEPA 83