BLASTX nr result
ID: Phellodendron21_contig00044884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044884 (597 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCX10093.1 Protein of unknown function [Pyronema omphalodes CBS ... 54 1e-06 >CCX10093.1 Protein of unknown function [Pyronema omphalodes CBS 100304] Length = 45 Score = 53.5 bits (127), Expect = 1e-06 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = +3 Query: 9 SSITKPINKAPGVKLPCWCGDDCSCCIIPCTIM 107 S++TKP K PCWCGDDCSCC+IPC IM Sbjct: 19 STVTKPPTK------PCWCGDDCSCCVIPCVIM 45