BLASTX nr result
ID: Phellodendron21_contig00044873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044873 (888 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KEQ89838.1 hypothetical protein M438DRAFT_330807 [Aureobasidium ... 60 1e-10 XP_013426232.1 apses-domain-containing protein, partial [Aureoba... 50 3e-07 >KEQ89838.1 hypothetical protein M438DRAFT_330807 [Aureobasidium pullulans EXF-150] Length = 851 Score = 59.7 bits (143), Expect(2) = 1e-10 Identities = 46/126 (36%), Positives = 57/126 (45%), Gaps = 33/126 (26%) Frame = -1 Query: 600 ALPSILHANNHGLDDTSWYQPST---------SLPALAHQQYQPS--------------- 493 ALPSI H + G DD WYQPS LPAL+ Q PS Sbjct: 135 ALPSISHVSARGFDD-QWYQPSNILQATSTAERLPALSQLQTFPSVGSSPRGSSITSAEP 193 Query: 492 ------AAPYQES---AYTTGLKTPSPEHPSHKRQDSVHQDLHSRNQGTNAFTTYDSATG 340 A Y S AY+TGLKTPSP+H R+DSV LH + + T+YD + Sbjct: 194 VCGADTATTYSSSFHGAYSTGLKTPSPDHTPAYRRDSVQSGLHGQ---SIPITSYDHNST 250 Query: 339 NYATMN 322 + +MN Sbjct: 251 SCISMN 256 Score = 35.4 bits (80), Expect(2) = 1e-10 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -3 Query: 307 YMDVGQGHMSHSSVTSA-TSAPAHYSSYHHNPPLQN 203 YMDV Q HMS S +SA S +HY++YH P+ + Sbjct: 261 YMDVSQSHMSSSIPSSAPPSGLSHYANYHQPQPISS 296 >XP_013426232.1 apses-domain-containing protein, partial [Aureobasidium namibiae CBS 147.97] KEQ72096.1 apses-domain-containing protein, partial [Aureobasidium namibiae CBS 147.97] Length = 706 Score = 50.4 bits (119), Expect(2) = 3e-07 Identities = 42/126 (33%), Positives = 54/126 (42%), Gaps = 33/126 (26%) Frame = -1 Query: 600 ALPSILHANNHGLDDTSWYQPST---------SLPALAHQQYQPS--------------- 493 ALPSI H G +D WYQP+ LPAL+ Q S Sbjct: 3 ALPSISHVQARGFED-QWYQPANVLQATSTAERLPALSQLQTFTSVGSSPRGSSITSAEP 61 Query: 492 ------AAPYQES---AYTTGLKTPSPEHPSHKRQDSVHQDLHSRNQGTNAFTTYDSATG 340 A Y S AY+TGLKTPSP+ R+DSV LH ++ T+YD + Sbjct: 62 ICGTDTATSYSSSFHGAYSTGLKTPSPDQTPAYRRDSVQSGLHGQSV---PITSYDQNSI 118 Query: 339 NYATMN 322 + +MN Sbjct: 119 SCISMN 124 Score = 33.1 bits (74), Expect(2) = 3e-07 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -3 Query: 307 YMDVGQGHMSHSSVTSATSAP--AHYSSYH 224 YMDV Q HMS SS+ S+ P HY+SYH Sbjct: 129 YMDVSQSHMS-SSIPSSAPPPGLGHYASYH 157