BLASTX nr result
ID: Phellodendron21_contig00044866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044866 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006433535.1 hypothetical protein CICLE_v10001779mg [Citrus cl... 60 3e-08 XP_006472199.1 PREDICTED: homeobox protein knotted-1-like 1 [Cit... 58 1e-07 >XP_006433535.1 hypothetical protein CICLE_v10001779mg [Citrus clementina] ESR46775.1 hypothetical protein CICLE_v10001779mg [Citrus clementina] Length = 334 Score = 60.1 bits (144), Expect = 3e-08 Identities = 30/38 (78%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +1 Query: 1 HWKPSEDTRFALLEGARVLGGNYNINEE-PMFLNTSDF 111 HWKPSED RFALLEGA LGGNY+ N+ PMFLNTSDF Sbjct: 297 HWKPSEDMRFALLEGA-TLGGNYSSNDRGPMFLNTSDF 333 >XP_006472199.1 PREDICTED: homeobox protein knotted-1-like 1 [Citrus sinensis] Length = 334 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 1 HWKPSEDTRFALLEGARVLGGNYNINEE-PMFLNTSDF 111 HWKPSED RFALLEGA LGGNY+ N+ PMFLNT DF Sbjct: 297 HWKPSEDMRFALLEGA-TLGGNYSSNDRGPMFLNTPDF 333