BLASTX nr result
ID: Phellodendron21_contig00044766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044766 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO57796.1 hypothetical protein CISIN_1g0414572mg, partial [Citr... 57 9e-09 OMO62869.1 hypothetical protein CCACVL1_22598 [Corchorus capsula... 55 7e-07 XP_006469736.1 PREDICTED: probable terpene synthase 9 isoform X2... 56 1e-06 XP_006469735.1 PREDICTED: probable terpene synthase 9 isoform X1... 56 1e-06 OMP07698.1 hypothetical protein COLO4_07128 [Corchorus olitorius] 55 2e-06 KJB60472.1 hypothetical protein B456_009G306700 [Gossypium raimo... 54 3e-06 >KDO57796.1 hypothetical protein CISIN_1g0414572mg, partial [Citrus sinensis] Length = 68 Score = 57.4 bits (137), Expect = 9e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 5 SQCIYNNGDGVGSSIGVTKDCLASLLLKPIPIEQ 106 +QCIY +GDG+GSS GVTKD L SL+LKPIPIEQ Sbjct: 35 AQCIYQHGDGIGSSNGVTKDRLVSLILKPIPIEQ 68 >OMO62869.1 hypothetical protein CCACVL1_22598 [Corchorus capsularis] Length = 212 Score = 55.5 bits (132), Expect = 7e-07 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +2 Query: 5 SQCIYNNGDGVGSSIGVTKDCLASLLLKPIPIEQ 106 +QC+Y +GDGVG+S GVTKDC+ S +LKPIPI++ Sbjct: 175 AQCMYQHGDGVGTSTGVTKDCIVSSILKPIPIQE 208 >XP_006469736.1 PREDICTED: probable terpene synthase 9 isoform X2 [Citrus sinensis] Length = 598 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 5 SQCIYNNGDGVGSSIGVTKDCLASLLLKPIPIEQ 106 +QCIY +GDG+GSS GVTKD L SL+L+PIPIEQ Sbjct: 565 AQCIYQHGDGIGSSEGVTKDRLVSLILEPIPIEQ 598 >XP_006469735.1 PREDICTED: probable terpene synthase 9 isoform X1 [Citrus sinensis] Length = 599 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 5 SQCIYNNGDGVGSSIGVTKDCLASLLLKPIPIEQ 106 +QCIY +GDG+GSS GVTKD L SL+L+PIPIEQ Sbjct: 566 AQCIYQHGDGIGSSEGVTKDRLVSLILEPIPIEQ 599 >OMP07698.1 hypothetical protein COLO4_07128 [Corchorus olitorius] Length = 504 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/34 (61%), Positives = 30/34 (88%) Frame = +2 Query: 5 SQCIYNNGDGVGSSIGVTKDCLASLLLKPIPIEQ 106 +QC+Y +GDGVG+S GVTKDC+ S +LKP+PI++ Sbjct: 467 AQCMYQHGDGVGTSTGVTKDCIVSSILKPVPIQE 500 >KJB60472.1 hypothetical protein B456_009G306700 [Gossypium raimondii] Length = 217 Score = 53.9 bits (128), Expect = 3e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +2 Query: 5 SQCIYNNGDGVGSSIGVTKDCLASLLLKPIPI 100 +QCIY +GDGVG+S GVTKDC+ S +L+PIPI Sbjct: 186 AQCIYQHGDGVGTSTGVTKDCIVSSILRPIPI 217