BLASTX nr result
ID: Phellodendron21_contig00044675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044675 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM16819.1 hypothetical protein XA68_1382 [Ophiocordyceps unilat... 77 9e-15 KXL47388.1 hypothetical protein FE78DRAFT_336128 [Acidomyces ric... 75 1e-14 XP_007781779.1 hypothetical protein W97_05560 [Coniosporium apol... 77 1e-14 XP_007829769.1 hypothetical protein PFICI_02997 [Pestalotiopsis ... 75 3e-14 XP_007921861.1 hypothetical protein MYCFIDRAFT_209985 [Pseudocer... 72 3e-14 OJJ04849.1 hypothetical protein ASPVEDRAFT_31281 [Aspergillus ve... 75 3e-14 OJJ55904.1 hypothetical protein ASPSYDRAFT_33917 [Aspergillus sy... 75 3e-14 XP_003856380.1 hypothetical protein MYCGRDRAFT_31676 [Zymoseptor... 71 3e-14 EKG18085.1 Zinc finger C2H2-type protein [Macrophomina phaseolin... 73 6e-14 KMU75334.1 hypothetical protein CISG_04753 [Coccidioides immitis... 74 7e-14 ENH86059.1 C2H2 conidiation transcription factor [Colletotrichum... 74 7e-14 KMP09401.1 hypothetical protein CIRG_09571 [Coccidioides immitis... 74 7e-14 EFW18921.1 hypothetical protein CPSG_04467 [Coccidioides posadas... 74 7e-14 XP_003072018.1 C2H2 type zinc finger containing protein [Coccidi... 74 7e-14 XP_001239027.1 C2H2 finger domain-containing protein [Coccidioid... 74 7e-14 OGM40452.1 C2H2 finger domain protein [Aspergillus bombycis] 74 9e-14 XP_015400986.1 C2H2 finger domain protein [Aspergillus nomius NR... 74 1e-13 XP_001248966.2 C2H2 finger domain-containing protein [Coccidioid... 74 1e-13 CRK23354.1 hypothetical protein BN1708_003639 [Verticillium long... 72 1e-13 OLN96598.1 C2H2 finger domain transcription factor mtfA [Colleto... 74 1e-13 >KOM16819.1 hypothetical protein XA68_1382 [Ophiocordyceps unilateralis] Length = 317 Score = 76.6 bits (187), Expect = 9e-15 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAM 149 GEKPF+CPHAGCGKAFSVRSNMKRHERGCH+ +AAM Sbjct: 268 GEKPFKCPHAGCGKAFSVRSNMKRHERGCHSYDAAM 303 >KXL47388.1 hypothetical protein FE78DRAFT_336128 [Acidomyces richmondensis] KYG49369.1 hypothetical protein M433DRAFT_316997 [Acidomyces richmondensis BFW] Length = 242 Score = 75.5 bits (184), Expect = 1e-14 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAM 149 GEKPF+CPHAGCGKAFSVRSNMKRHERGCH +A M Sbjct: 203 GEKPFKCPHAGCGKAFSVRSNMKRHERGCHTGSAGM 238 >XP_007781779.1 hypothetical protein W97_05560 [Coniosporium apollinis CBS 100218] EON66462.1 hypothetical protein W97_05560 [Coniosporium apollinis CBS 100218] Length = 377 Score = 76.6 bits (187), Expect = 1e-14 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAA-NAAMT 146 GEKPF+CPH+GCGKAFSVRSNMKRHERGCHAA NAAM+ Sbjct: 337 GEKPFKCPHSGCGKAFSVRSNMKRHERGCHAAGNAAMS 374 >XP_007829769.1 hypothetical protein PFICI_02997 [Pestalotiopsis fici W106-1] ETS84972.1 hypothetical protein PFICI_02997 [Pestalotiopsis fici W106-1] Length = 298 Score = 75.1 bits (183), Expect = 3e-14 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTGM 140 GEKPF+CPH+GCGKAFSVRSNMKRHERGCH A+ +GM Sbjct: 259 GEKPFKCPHSGCGKAFSVRSNMKRHERGCHNFEASSSGM 297 >XP_007921861.1 hypothetical protein MYCFIDRAFT_209985 [Pseudocercospora fijiensis CIRAD86] EME89096.1 hypothetical protein MYCFIDRAFT_209985 [Pseudocercospora fijiensis CIRAD86] Length = 120 Score = 71.6 bits (174), Expect = 3e-14 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANA 155 GEKPFRCPH GCGKAFSVRSNMKRHERGCH+ A Sbjct: 77 GEKPFRCPHNGCGKAFSVRSNMKRHERGCHSGMA 110 >OJJ04849.1 hypothetical protein ASPVEDRAFT_31281 [Aspergillus versicolor CBS 583.65] Length = 312 Score = 75.1 bits (183), Expect = 3e-14 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTGML 137 GEKPFRC HAGCGKAFSVRSNMKRHERGCH A T M+ Sbjct: 273 GEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRAVATAMV 312 >OJJ55904.1 hypothetical protein ASPSYDRAFT_33917 [Aspergillus sydowii CBS 593.65] Length = 313 Score = 75.1 bits (183), Expect = 3e-14 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTGML 137 GEKPFRC HAGCGKAFSVRSNMKRHERGCH A T M+ Sbjct: 274 GEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRAVATAMV 313 >XP_003856380.1 hypothetical protein MYCGRDRAFT_31676 [Zymoseptoria tritici IPO323] EGP91356.1 hypothetical protein MYCGRDRAFT_31676 [Zymoseptoria tritici IPO323] Length = 97 Score = 70.9 bits (172), Expect = 3e-14 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAM 149 GEKPF+CPH+GCGKAFSVRSNMKRHERGCH M Sbjct: 56 GEKPFKCPHSGCGKAFSVRSNMKRHERGCHGGMGHM 91 >EKG18085.1 Zinc finger C2H2-type protein [Macrophomina phaseolina MS6] Length = 223 Score = 73.2 bits (178), Expect = 6e-14 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHA 164 GEKPF+CPHAGCGKAFSVRSNMKRHERGCHA Sbjct: 184 GEKPFKCPHAGCGKAFSVRSNMKRHERGCHA 214 >KMU75334.1 hypothetical protein CISG_04753 [Coccidioides immitis RMSCC 3703] Length = 329 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAA 152 GEKPFRCPHAGCGKAFSVRSNMKRHERGCH +A Sbjct: 288 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHPGRSA 322 >ENH86059.1 C2H2 conidiation transcription factor [Colletotrichum orbiculare MAFF 240422] Length = 330 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTG 143 GEKPF+CPHAGCGKAFSVRSNMKRHERGCH + TG Sbjct: 291 GEKPFKCPHAGCGKAFSVRSNMKRHERGCHNFESGSTG 328 >KMP09401.1 hypothetical protein CIRG_09571 [Coccidioides immitis RMSCC 2394] KMU88490.1 hypothetical protein CIHG_06290 [Coccidioides immitis H538.4] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAA 152 GEKPFRCPHAGCGKAFSVRSNMKRHERGCH +A Sbjct: 295 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHPGRSA 329 >EFW18921.1 hypothetical protein CPSG_04467 [Coccidioides posadasii str. Silveira] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAA 152 GEKPFRCPHAGCGKAFSVRSNMKRHERGCH +A Sbjct: 295 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHPGRSA 329 >XP_003072018.1 C2H2 type zinc finger containing protein [Coccidioides posadasii C735 delta SOWgp] EER29873.1 C2H2 type zinc finger containing protein [Coccidioides posadasii C735 delta SOWgp] KMM71261.1 hypothetical protein CPAG_07568 [Coccidioides posadasii RMSCC 3488] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAA 152 GEKPFRCPHAGCGKAFSVRSNMKRHERGCH +A Sbjct: 295 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHPGRSA 329 >XP_001239027.1 C2H2 finger domain-containing protein [Coccidioides immitis RS] EAS27444.3 C2H2 finger domain-containing protein [Coccidioides immitis RS] Length = 336 Score = 74.3 bits (181), Expect = 7e-14 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAA 152 GEKPFRCPHAGCGKAFSVRSNMKRHERGCH +A Sbjct: 295 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHPGRSA 329 >OGM40452.1 C2H2 finger domain protein [Aspergillus bombycis] Length = 319 Score = 73.9 bits (180), Expect = 9e-14 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTGML 137 GEKPFRC HAGCGKAFSVRSNMKRHERGCH + T M+ Sbjct: 280 GEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRSVATAMV 319 >XP_015400986.1 C2H2 finger domain protein [Aspergillus nomius NRRL 13137] KNG80063.1 C2H2 finger domain protein [Aspergillus nomius NRRL 13137] Length = 327 Score = 73.9 bits (180), Expect = 1e-13 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTGML 137 GEKPFRC HAGCGKAFSVRSNMKRHERGCH + T M+ Sbjct: 288 GEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRSVATAMV 327 >XP_001248966.2 C2H2 finger domain-containing protein [Coccidioides immitis RS] EAS37383.2 C2H2 finger domain-containing protein [Coccidioides immitis RS] Length = 327 Score = 73.9 bits (180), Expect = 1e-13 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTGML 137 GEKPFRCPH GCGKAFSVRSNMKRHERGCH A + L Sbjct: 286 GEKPFRCPHVGCGKAFSVRSNMKRHERGCHTGRATTSSTL 325 >CRK23354.1 hypothetical protein BN1708_003639 [Verticillium longisporum] Length = 174 Score = 71.6 bits (174), Expect = 1e-13 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAA 152 GEKPF+CPH GCGKAFSVRSNMKRHERGCH+ + A Sbjct: 136 GEKPFKCPHGGCGKAFSVRSNMKRHERGCHSFDGA 170 >OLN96598.1 C2H2 finger domain transcription factor mtfA [Colletotrichum chlorophyti] Length = 330 Score = 73.9 bits (180), Expect = 1e-13 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -3 Query: 256 GEKPFRCPHAGCGKAFSVRSNMKRHERGCHAANAAMTG 143 GEKPF+CPHAGCGKAFSVRSNMKRHERGCH TG Sbjct: 286 GEKPFKCPHAGCGKAFSVRSNMKRHERGCHNFETGSTG 323