BLASTX nr result
ID: Phellodendron21_contig00044552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044552 (1840 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV96717.1 hypothetical protein PTTG_07673 [Puccinia triticina 1... 62 2e-06 >OAV96717.1 hypothetical protein PTTG_07673 [Puccinia triticina 1-1 BBBD Race 1] Length = 771 Score = 62.0 bits (149), Expect = 2e-06 Identities = 40/117 (34%), Positives = 57/117 (48%), Gaps = 4/117 (3%) Frame = -2 Query: 855 GNMTVPATPTAYGSSPGSFSNSGANRSGSETPTGSENSSLVSTPTGTAPFANGNSSYPAG 676 GN P++ + G +NSG SGS+ P+GS++SS +G +N S+YPAG Sbjct: 580 GNSNYPSSDSGSAYPSGGGTNSG---SGSQYPSGSDSSS-----SGYPGSSNSGSAYPAG 631 Query: 675 ATGPVPSAY----GNSTYPYATGGLPAYATGTGYFIPGTTSPLATSAAPGNQTYPFG 517 T SAY G S YP + GG ++ G P + + + PGN YP G Sbjct: 632 GTSTTGSAYPSSGGGSAYPSSGGGSAHRSSDGGSAYPSSGGGSGSPSTPGNSDYPSG 688