BLASTX nr result
ID: Phellodendron21_contig00044488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044488 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM22370.1 hypothetical protein ST47_g6475 [Ascochyta rabiei] 57 4e-07 XP_013429280.1 hypothetical protein M436DRAFT_80137 [Aureobasidi... 53 1e-05 >KZM22370.1 hypothetical protein ST47_g6475 [Ascochyta rabiei] Length = 344 Score = 57.4 bits (137), Expect = 4e-07 Identities = 23/52 (44%), Positives = 37/52 (71%) Frame = -3 Query: 396 IPGWKATPEQKRALEEMMGAVNEQEMPSEEDLQAMSGAGAAETSKATTEISK 241 +PGWKAT QK+ LE+M+G +NEQE P +++L++ + GA++ K E +K Sbjct: 155 LPGWKATESQKKQLEKMIGQINEQETPGKDELESWTSEGASDDQKEAMETAK 206 >XP_013429280.1 hypothetical protein M436DRAFT_80137 [Aureobasidium namibiae CBS 147.97] KEQ74663.1 hypothetical protein M436DRAFT_80137 [Aureobasidium namibiae CBS 147.97] Length = 199 Score = 52.8 bits (125), Expect = 1e-05 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = -3 Query: 396 IPGWKATPEQKRALEEMMGAVNEQEMPSEEDLQAMSGAG 280 +PGWKAT +QK+ LE+M+ VNEQ+ PS +DL+AM+ G Sbjct: 160 LPGWKATDDQKQNLEKMINQVNEQKTPSSKDLEAMASGG 198