BLASTX nr result
ID: Phellodendron21_contig00044275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044275 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007672489.1 hypothetical protein BAUCODRAFT_29747 [Baudoinia ... 59 4e-07 >XP_007672489.1 hypothetical protein BAUCODRAFT_29747 [Baudoinia panamericana UAMH 10762] EMD01305.1 hypothetical protein BAUCODRAFT_29747 [Baudoinia panamericana UAMH 10762] Length = 386 Score = 58.5 bits (140), Expect = 4e-07 Identities = 37/65 (56%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = -3 Query: 471 FTSPEDEYANDALAEPIVPP-RSPERRNSPQVHYISGHELSNFDFGLSESQLRELREAGS 295 F S EDE AND L PIVPP RSPERR SP VHY S E+S FDF S R R S Sbjct: 308 FASEEDEEAND-LVSPIVPPARSPERRYSPMVHYPSWSEVSEFDF--SGEGRRSTRNTSS 364 Query: 294 LEDTA 280 ED + Sbjct: 365 NEDVS 369