BLASTX nr result
ID: Phellodendron21_contig00044116
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044116 (539 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO60172.1 hypothetical protein CISIN_1g040498mg [Citrus sinensis] 53 3e-06 XP_006424532.1 hypothetical protein CICLE_v10029727mg [Citrus cl... 53 3e-06 >KDO60172.1 hypothetical protein CISIN_1g040498mg [Citrus sinensis] Length = 73 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +2 Query: 221 SRALAEEDQNVKSDENPPIDVNNHHYIPRQDFNKY 325 SR L+E D NVKS PP +VNNHHYIPRQDFN+Y Sbjct: 31 SRVLSEGDPNVKSGY-PPSNVNNHHYIPRQDFNQY 64 >XP_006424532.1 hypothetical protein CICLE_v10029727mg [Citrus clementina] ESR37772.1 hypothetical protein CICLE_v10029727mg [Citrus clementina] Length = 77 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +2 Query: 221 SRALAEEDQNVKSDENPPIDVNNHHYIPRQDFNKY 325 SR L+E D NVKS PP +VNNHHYIPRQDFN+Y Sbjct: 35 SRVLSEGDPNVKSGY-PPSNVNNHHYIPRQDFNQY 68