BLASTX nr result
ID: Phellodendron21_contig00044092
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044092 (475 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO76232.1 hypothetical protein CISIN_1g039710mg, partial [Citru... 55 6e-06 >KDO76232.1 hypothetical protein CISIN_1g039710mg, partial [Citrus sinensis] Length = 331 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 90 IVMPEMQISVRLPMLDLSQPVHPSFLSSLS 1 IVMPE+QISVRLP+LDLSQPV PSFLSSLS Sbjct: 1 IVMPELQISVRLPVLDLSQPVSPSFLSSLS 30