BLASTX nr result
ID: Phellodendron21_contig00044057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00044057 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006453410.1 hypothetical protein CICLE_v10010545mg [Citrus cl... 57 2e-07 XP_006453417.1 hypothetical protein CICLE_v10010221mg [Citrus cl... 56 4e-07 >XP_006453410.1 hypothetical protein CICLE_v10010545mg [Citrus clementina] ESR66650.1 hypothetical protein CICLE_v10010545mg [Citrus clementina] Length = 527 Score = 56.6 bits (135), Expect = 2e-07 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = +2 Query: 14 KKSDQGRSMAKLLSSRPSSSQTDSL--AQYNPQSETKFQDNGATDKGVEDS 160 KK DQ RS KL SSRPS+SQ D Q +PQS+T+FQDNGA D GVEDS Sbjct: 211 KKRDQDRS--KLSSSRPSTSQRDDSISGQDDPQSDTEFQDNGAIDMGVEDS 259 >XP_006453417.1 hypothetical protein CICLE_v10010221mg [Citrus clementina] ESR66657.1 hypothetical protein CICLE_v10010221mg [Citrus clementina] Length = 522 Score = 55.8 bits (133), Expect = 4e-07 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = +2 Query: 14 KKSDQGRSMAKLLSSRPSSS-QTDSLA-QYNPQSETKFQDNGATDKGVEDS 160 KK DQ RS KL SSRPS+S Q DS++ Q +PQS+T+FQDNGA D GVEDS Sbjct: 211 KKRDQDRS--KLSSSRPSTSRQDDSISGQDDPQSDTEFQDNGAIDMGVEDS 259