BLASTX nr result
ID: Phellodendron21_contig00043940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043940 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO49486.1 hypothetical protein CISIN_1g003637mg [Citrus sinensis] 70 7e-12 XP_006423405.1 hypothetical protein CICLE_v10027807mg [Citrus cl... 70 7e-12 XP_006423406.1 hypothetical protein CICLE_v10027807mg [Citrus cl... 70 7e-12 XP_006487335.1 PREDICTED: DNA replication licensing factor MCM4 ... 69 2e-11 >KDO49486.1 hypothetical protein CISIN_1g003637mg [Citrus sinensis] Length = 806 Score = 70.1 bits (170), Expect = 7e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 184 NGQRQATLLSSTEDVPLSSSEADDEMDEATPTFVWATNISEQ 309 NGQR AT SST+DVPLSSSEA D+MDEATPTFVW TNIS Q Sbjct: 87 NGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQ 128 >XP_006423405.1 hypothetical protein CICLE_v10027807mg [Citrus clementina] ESR36645.1 hypothetical protein CICLE_v10027807mg [Citrus clementina] Length = 806 Score = 70.1 bits (170), Expect = 7e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 184 NGQRQATLLSSTEDVPLSSSEADDEMDEATPTFVWATNISEQ 309 NGQR AT SST+DVPLSSSEA D+MDEATPTFVW TNIS Q Sbjct: 87 NGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQ 128 >XP_006423406.1 hypothetical protein CICLE_v10027807mg [Citrus clementina] ESR36646.1 hypothetical protein CICLE_v10027807mg [Citrus clementina] Length = 846 Score = 70.1 bits (170), Expect = 7e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 184 NGQRQATLLSSTEDVPLSSSEADDEMDEATPTFVWATNISEQ 309 NGQR AT SST+DVPLSSSEA D+MDEATPTFVW TNIS Q Sbjct: 87 NGQRHATSPSSTDDVPLSSSEAGDDMDEATPTFVWGTNISVQ 128 >XP_006487335.1 PREDICTED: DNA replication licensing factor MCM4 [Citrus sinensis] Length = 846 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +1 Query: 184 NGQRQATLLSSTEDVPLSSSEADDEMDEATPTFVWATNISEQ 309 NGQR AT SST+DVPLSSSEA D++DEATPTFVW TNIS Q Sbjct: 87 NGQRHATSPSSTDDVPLSSSEAGDDLDEATPTFVWGTNISVQ 128