BLASTX nr result
ID: Phellodendron21_contig00043876
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043876 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006477031.1 PREDICTED: snurportin-1 [Citrus sinensis] 58 5e-08 GAV56561.1 hypothetical protein CFOL_v3_00103 [Cephalotus follic... 57 1e-07 KDO52662.1 hypothetical protein CISIN_1g0147512mg, partial [Citr... 56 2e-07 KDO52660.1 hypothetical protein CISIN_1g0147512mg, partial [Citr... 56 2e-07 XP_006440111.1 hypothetical protein CICLE_v10020324mg [Citrus cl... 56 3e-07 XP_006440112.1 hypothetical protein CICLE_v10020324mg [Citrus cl... 56 3e-07 XP_019232236.1 PREDICTED: snurportin-1 [Nicotiana attenuata] OIT... 55 4e-07 XP_016432952.1 PREDICTED: snurportin-1-like [Nicotiana tabacum] 55 4e-07 XP_009774415.1 PREDICTED: snurportin-1 [Nicotiana sylvestris] XP... 55 4e-07 XP_009613386.1 PREDICTED: snurportin-1 [Nicotiana tomentosiformis] 55 4e-07 OAY30687.1 hypothetical protein MANES_14G051500 [Manihot esculenta] 55 6e-07 XP_012079838.1 PREDICTED: snurportin-1 [Jatropha curcas] KDP3091... 55 6e-07 KJB51200.1 hypothetical protein B456_008G206000 [Gossypium raimo... 54 1e-06 XP_016697485.1 PREDICTED: snurportin-1 [Gossypium hirsutum] 54 1e-06 XP_012438999.1 PREDICTED: snurportin-1 [Gossypium raimondii] KJB... 54 1e-06 XP_017634648.1 PREDICTED: snurportin-1 [Gossypium arboreum] KHG2... 54 1e-06 XP_016565089.1 PREDICTED: snurportin-1 [Capsicum annuum] 54 1e-06 ONK77249.1 uncharacterized protein A4U43_C02F4610 [Asparagus off... 54 2e-06 XP_007037976.2 PREDICTED: snurportin-1 isoform X1 [Theobroma cacao] 54 2e-06 OAY80498.1 Snurportin-1 [Ananas comosus] 54 2e-06 >XP_006477031.1 PREDICTED: snurportin-1 [Citrus sinensis] Length = 419 Score = 58.2 bits (139), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS YHKF+FSTVPVY Sbjct: 206 RFFWLNSKLAETGACDAPSHYHKFRFSTVPVY 237 >GAV56561.1 hypothetical protein CFOL_v3_00103 [Cephalotus follicularis] Length = 410 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC+SPS+YH+F+FS+VPVY Sbjct: 197 RFFWLNSKLAETGACDSPSQYHRFRFSSVPVY 228 >KDO52662.1 hypothetical protein CISIN_1g0147512mg, partial [Citrus sinensis] Length = 221 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS Y+KF+FSTVPVY Sbjct: 164 RFFWLNSKLAETGACDAPSHYYKFRFSTVPVY 195 >KDO52660.1 hypothetical protein CISIN_1g0147512mg, partial [Citrus sinensis] KDO52661.1 hypothetical protein CISIN_1g0147512mg, partial [Citrus sinensis] Length = 263 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS Y+KF+FSTVPVY Sbjct: 206 RFFWLNSKLAETGACDAPSHYYKFRFSTVPVY 237 >XP_006440111.1 hypothetical protein CICLE_v10020324mg [Citrus clementina] ESR53351.1 hypothetical protein CICLE_v10020324mg [Citrus clementina] Length = 392 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS Y+KF+FSTVPVY Sbjct: 206 RFFWLNSKLAETGACDAPSHYYKFRFSTVPVY 237 >XP_006440112.1 hypothetical protein CICLE_v10020324mg [Citrus clementina] ESR53352.1 hypothetical protein CICLE_v10020324mg [Citrus clementina] Length = 419 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS Y+KF+FSTVPVY Sbjct: 206 RFFWLNSKLAETGACDAPSHYYKFRFSTVPVY 237 >XP_019232236.1 PREDICTED: snurportin-1 [Nicotiana attenuata] OIT06658.1 hypothetical protein A4A49_09485 [Nicotiana attenuata] Length = 432 Score = 55.5 bits (132), Expect = 4e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS YH++KFST+PVY Sbjct: 219 RFFWLNSKLAETGACDAPSTYHRYKFSTLPVY 250 >XP_016432952.1 PREDICTED: snurportin-1-like [Nicotiana tabacum] Length = 433 Score = 55.5 bits (132), Expect = 4e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS YH++KFST+PVY Sbjct: 220 RFFWLNSKLAETGACDAPSTYHRYKFSTLPVY 251 >XP_009774415.1 PREDICTED: snurportin-1 [Nicotiana sylvestris] XP_016498035.1 PREDICTED: snurportin-1-like [Nicotiana tabacum] Length = 433 Score = 55.5 bits (132), Expect = 4e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS YH++KFST+PVY Sbjct: 220 RFFWLNSKLAETGACDAPSTYHRYKFSTLPVY 251 >XP_009613386.1 PREDICTED: snurportin-1 [Nicotiana tomentosiformis] Length = 433 Score = 55.5 bits (132), Expect = 4e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS YH++KFST+PVY Sbjct: 220 RFFWLNSKLAETGACDAPSTYHRYKFSTLPVY 251 >OAY30687.1 hypothetical protein MANES_14G051500 [Manihot esculenta] Length = 426 Score = 55.1 bits (131), Expect = 6e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL ETGACN PS YHK++FSTVP+Y Sbjct: 213 RFFWLNSKLGETGACNPPSFYHKYRFSTVPIY 244 >XP_012079838.1 PREDICTED: snurportin-1 [Jatropha curcas] KDP30919.1 hypothetical protein JCGZ_11295 [Jatropha curcas] Length = 426 Score = 55.1 bits (131), Expect = 6e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL ETGACN PS YHK++FSTVP+Y Sbjct: 213 RFFWLNSKLGETGACNPPSFYHKYRFSTVPIY 244 >KJB51200.1 hypothetical protein B456_008G206000 [Gossypium raimondii] Length = 339 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL E+GACN+PS YHKF+FS VPVY Sbjct: 209 RFYWLNSKLEESGACNAPSHYHKFRFSAVPVY 240 >XP_016697485.1 PREDICTED: snurportin-1 [Gossypium hirsutum] Length = 422 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL E+GACN+PS YHKF+FS VPVY Sbjct: 209 RFYWLNSKLEESGACNAPSHYHKFRFSAVPVY 240 >XP_012438999.1 PREDICTED: snurportin-1 [Gossypium raimondii] KJB51199.1 hypothetical protein B456_008G206000 [Gossypium raimondii] Length = 422 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL E+GACN+PS YHKF+FS VPVY Sbjct: 209 RFYWLNSKLEESGACNAPSHYHKFRFSAVPVY 240 >XP_017634648.1 PREDICTED: snurportin-1 [Gossypium arboreum] KHG25528.1 Snurportin-1 [Gossypium arboreum] Length = 422 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL E+GACN+PS YHKF+FS VPVY Sbjct: 209 RFYWLNSKLEESGACNAPSHYHKFRFSAVPVY 240 >XP_016565089.1 PREDICTED: snurportin-1 [Capsicum annuum] Length = 430 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKLAETGAC++PS YH+++FST+PVY Sbjct: 217 RFFWLNSKLAETGACDAPSTYHRYRFSTLPVY 248 >ONK77249.1 uncharacterized protein A4U43_C02F4610 [Asparagus officinalis] Length = 422 Score = 53.9 bits (128), Expect = 2e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL ETGACN PS+YHK++F+ VP+Y Sbjct: 209 RFFWLNSKLGETGACNPPSKYHKYRFAAVPIY 240 >XP_007037976.2 PREDICTED: snurportin-1 isoform X1 [Theobroma cacao] Length = 422 Score = 53.9 bits (128), Expect = 2e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSK+ E+GACN PS YHKF+FSTVPVY Sbjct: 209 RFFWLNSKIEESGACNPPSCYHKFRFSTVPVY 240 >OAY80498.1 Snurportin-1 [Ananas comosus] Length = 397 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 97 RVIFLNSKLAETGACNSPSRYHKFKFSTVPVY 2 R +LNSKL ETGACN PS YHK++FS VP+Y Sbjct: 208 RFFWLNSKLTETGACNPPSTYHKYRFSIVPIY 239