BLASTX nr result
ID: Phellodendron21_contig00043854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00043854 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO57865.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] 67 4e-11 >KDO57865.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] Length = 262 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/68 (57%), Positives = 46/68 (67%), Gaps = 10/68 (14%) Frame = +2 Query: 125 KPTEELQNSFRFKCYLLVSKIYKVFMSWHLSTN---IFYHQFLL-------FDYRLQ*FF 274 +PT EL+NSFRFKCYLLVSKIYKVF+SWHLST + + FLL F Y L F Sbjct: 196 EPTAELRNSFRFKCYLLVSKIYKVFLSWHLSTAPYILIINFFLLMIGFNSSFLY-LSHSF 254 Query: 275 PKSVCVCV 298 P VC+C+ Sbjct: 255 PLCVCLCM 262